ELF54l4 (*)44````%LLPdd  /usr/lib/ld.so.1;x80XHثxȽ PHpxԬ(< !#$%')*+,-./0245789<>?@ABCEHKMNPQRTVWXY[\]^`bcdeghjmnopqstuvxyz}~  "&(136:;=DFGIJLOSUZ_afiklrw{|)  _  * p  P* 4P3 K1 ^B oоK #.7 D7 PYb@JB sQU pQ S `lM l  m pn  %  , 1 90 B6 K\  n@3  @ h PH  b  L p 5c Hp' Y g@ # Į.3ET 42314h35"&.+/5zExVlb2m.w\44t//341f 4̮t00 30"tD `%/EJD2Wr e 1d/4L2t | $0T5`2|$15 /`(7F 18@8GT3N b y q`w|6v }pp @ 2D04D1 t325@;7 :Ȯ F 24"0V +} 0~?3Q@x ]T/d1m1t2|d32/1`d0UU 0v 1d41`o  T2D3v  `45 3d126t5.4D/1`U 9G0yk RT0X0> ]0cnP1 }4/6  d3.$35%.0/40T4 $2`! 50$ 0+ f7 5"O V /[ $4i t4q pD | 0 5" 41 ; 4  j . d2/2 43 p t1 D $5( t @2 D4A 4a 3v 4   t2 0 /|/ 3  h/@ y. 4/^1 5" 0 $/ T1 P1 & D52 d5@ 1clamscanfsr.scrti.svalues-Xa.ccrtstuff.c__do_global_dtors_auxframe_dummyoutput.cgetopt.c_getopt_internaloptparser.coptget_ioptaddoptaddargactions.caction_removegetdestaction_copyaction_movemisc.cclamscan.cmanager.cprecheckaccessprint_chain.clone.0.clone.1cl_engine_set_clcb_metapostcl_scanfilescandirsunwind-dw2-fde.c__gthread_triggerfde_unencoded_compareframe_downheapframe_heapsortsize_of_encoded_valueread_encoded_value_with_baseget_cie_encodingbase_from_object.clone.3classify_object_over_fdesfde_single_encoding_comparelinear_search_fdesadd_fdes.clone.4search_objectfde_mixed_encoding_compare__do_global_ctors_auxcrtn.s_Unwind_Find_FDE__deregister_frame_info_bases__register_frame_info_bases__register_frame_info_table__deregister_frame_info__register_frame_info__register_frame_table__deregister_frame__register_frame__register_frame_info_table_basesopterrstrlenfputclogg_facilitycli_ctimereallocstrpbrknotmovedcl_engine_set_clcb_pre_cachelogg_timecl_always_gen_section_hashpthread_once_exitcli_chompmprintf_verbosemprintf_disabledlogg_rotatecl_cvdhead__fpstartlogg_syslogcl_engine_set_clcb_stats_get_hostidfputs___errnolstat64getrlimitatoioptadditemcl_engine_compileprintcleanactionfilenofprintfcl_strerrorfgetsbellcheck_flevelmprintf_send_timeout__iobcl_retflevelprint_version__1cG__CrunMdo_exit_code6F_v_fopencloselogcl_engine_stats_enable_DYNAMICsigemptysetfileliststrcpyfread_environgettimeofdaymprintf_quietcli_regcomp_startfflush_GLOBAL_OFFSET_TABLE_mdprintf_edata__clam_optionssetgid_Jv_RegisterClassescli_is_abspath_fini__fsrget_versionscanmanagervsnprintfrename_lib_versionclosedircli_regfree__fsr_init_valuewaitsigprocmask__longdouble_usedperrorlogg_closemy_getoptsigaddsetoptparsemainmprintf_stdoutcl_cleanup_cryptomatch_regexfclosebasenameunlinkstrncpysetuidcli_filecopycl_retdbdirlogg_fpoptgetgetenvmprintf_nowarndaemonizestrchrcl_engine_set_stractsetupdup2getpwnam_etextgetcwdopendirstrcasecmpcl_initialize_cryptooptfreeprintinfectedcountlinesumaskloggfcntlnotremovedmy_getopt_longcl_engine_get_num_mcountis_valid_hostidlogg_verbosereaddiratexit___Argvcl_debugabortstrncmprecursionstrftimecl_engine_set_numcl_cvdfreecli_sigperf_printcalloclogg_nowarn_get_exit_frame_monitoroptargsendcl_engine_newcl_loadfreshdbdirlocaltime_rpthread_mutex_unlockcli_regexecmprintfcl_initoptindlogg_noflush_PROCEDURE_LINKAGE_TABLE_forkgeteuidlogg_sizestrtouloptoptcli_sigperf_events_destroylogg_filecl_engine_freecl_engine_set_clcb_stats_submitcl_scandesc_callbackcl_engine_set_clcb_post_scanlogg_locklogg_foregroundsetsidstrdupfwritememcpy_end__environ_lockhelpmallocpthread_mutex_lockstrcmpselectstrrchrmy_getopt_long_onlycli_gentempcli_gettmpdirsprintflibclamav.so.6CLAMAV_PUBLICCLAMAV_PRIVATElibsocket.so.1SUNW_0.7libpthread.so.1SUNW_1.2SUNW_0.9libc.so.1SUNW_1.1SYSVABI_1.3SUNWprivate_1.1libxml2.so.2libz.so.1libbz2.so.1libiconv.so.2libstdc++.so.6libssl.so.1.0.0libcrypto.so.1.0.0libm.so.2libnsl.so.1/usr/local/libH 0Ӈ_ W Ee t  (=   0'=  (=   '=  (=  7 qN                                          r|u>U}c^jz!"#$%&'~k)*+,-./0123456  {wth`;WDKJIpXB]N_*?J< lpt xtuY,9_ĨȨ̨ШԨب2ܨFyb{ d "g7 I$(q,04[8Z<@+DHiL`PTX\`(dkhlp\tEx^|/RLr5W l>]K!ĩpȩ̩ЩHԩةܩh-~S No $3(,s48 @DH5d%h%lh%ph%th%xh%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%Ĩh%Ȩh%̨h%Шh%Ԩhp%بh`%ܨhP%h@%h0%h %h%h%h%h%h%h%h%h % h(%h0%h8p%h@`%hHP% hP@%$hX0%(h` %,hh%0hp%4hx%8h%<h%@h%Dh%Hh%Lh%Ph%Thp%Xh`%\hP%`h@%dh0%hh %lh%ph%th%xh%|h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%ĩh%ȩh%̩h%Щh%ԩhp%ةh`%ܩhP%h@%h0%h %h%h%h%h%h%h%h%h % h(%h0%h8p%h@`%hHP% hP@%$hX0%(h` %,hh%4hp%8hx%@h%Dh%HhjjLt Rh`tt PE`u T`RU RP`#mG$D$UD$$YURQ  tX<$у $t$$у`tƒ 3f$$f $tf$$f $,$YZ]ÐÐUVSVqu])9s 9r拃t$ƃ[^]US\p t$D$\$ D$$0t$t $Ѓ[]Ë$ÐUWVSu M84$8ǃTtH1 t&9s9<%u;&U:?y:V;U: ĮS}:l5?uvE1ҋM<:ˆE +Mt -R}:EE<:E,fB<-tTEU\$D$$ Mj=5zuu50u5 ;}uD5.uE5ƉD$ D$8$D$y5:u{&UWVS\}EEUԋU M$E؉UW1ɻ+E+UE9Uԍ4-U+-]ŰMu9-uxtME؋UԉL$MЉ$E|$9]܉;uԉىEt&y9} t&ȉыTQ9|9}빐xu@fEܾ9E}E\[^_]ÐP-UtĀ}2}--6uȋ]ȋEȃ]XE-=h`uEt 0=uM؋ ɉM=U؉+E]̉uE1Ӊf{A<$k;EuUM<$T$L$@uȉu]̉È=EE؃xUtM̋U P@ 1E܋E܃&]-6uȀ~ދU&W9  :u׃1ۀ< :Ѝ&MЋE :M+t -}:U1 :Uv;p뎐t&UЋMԋ]T$L$$7ơvEЋUԋMEU M\[^_] fUȃEZEEE؋xĮ?MԉD$ D$`$D$]`Eܾt&]̋u1+E]uuËEEEt&\$t$$uE}̋U؃uӃ}]uEtcĮ?mE܋Mȋ]ԃL$ D$$D$-'&u1}>=Į?E܋UԃEȉD$ D$7$D$E]9]m1ҋ Į}:…ɉ֍t:MԉD$ D$$D$d]MȍT1pu;M܋]ԋOp ]g&'S\$ T$D$L$\$\$D$\$[ S\$ T$D$L$\$\$D$\$[?UVSÃu:[(t-tt$$stCt܉t$$\ũ[^]Ít&'UWVS,E؋EU܋U$0EU<$,(UU$ CE E $CCEUC SvNCEUC$C(CECC,C tVU1X(,[^_]fv뫐UDE CSCC]fU1C(E܉롋C$v$g$_z$Rm'U8]]uu }ωU@uaJ1uJBU܉$<$U܅BZ rBB1]u}]Ð@tUD$0$VU܅tU܉<$EMAUY ӉqËC$uK$BBsfJ Z\SB1Nt&B$ED$$D$9D$ D$"D$$kD$ D$"D$$?MD$ D$"D$$M $U'UVS]u u 8t&[(t-tt$$tCt܉t$$lũ[^]Ít&'UWVS}W,t-tf$W,u$v_$t8Stj$C$yC$ns$$cuȋ$SG$HG$=_(<$2t뎍[$농v[^_]UWVS| M EEtE EƅP:=Ȯ1DžDžDžGfS$E!=tu Et!UtU E=Ȯ07 uSuUV MD$W $iDžPDžt&ED$$L$s ]؉ڋ !%tDJD1)ڃ&3< $9|3$EY5P#KYq D$a $ P$1t&L4 .;|44$}~ t&T t t u4 >"GMȉL9 P 4RU5ȮV$UUMUL$ D$l$D$_Strw9C { t {DŽDŽCCuH P{ ƄP:C KƄP:DŽ:&T$C D$CSD$T$ CU܉D$C$ED$ D$?D$$,t&< vV$f"E}MT$ D$`$D$gEU䍍T$UPL$ M ED$T$ $$Q:AD$P$zt59A199|t$D$$@Uut ~ zFF ED$T$Uȉ$$D$D$ D$|$$5F M$T$ }D$$D$Lt$uM]]| [^_]À D$ D$)D$$lCE$| 1[^_]ËE=~D$"<$L~~}D$$L$ D$@&tyxUD$d<$t,D$k<$tD$m<$114$rD$$1E؉<$D$D$lDžlj8"t:ED$$fxt/P@ D$T$ D$8$萖E)D$$!xt/P8@ D$T$ $D$KED$$ܶxt/P@ D$T$ 8D$$ED$$藶xt/P@ D$T$ D$8$ED$)$Rxt/P8@ D$T$ $D$|ED$8$ xt/P@ D$T$ 8D$$7EcD$D$ȵxD$M$貵ց xD$Z$E莵xD$i$ErxD$$ESxD$$E4xD$$E@xD$$ExD$$E xD$$EĴ xD$$E訴xD$$E茴@xD$$Ep@xD$$EQxD$$E5xD$$ExD$$E@xD$,$E޳x[@{,D$$讳xuC,D$>$G.{,U䉕4tD$$lx< D044$D$,$ HL$$1у~  8/tv< / u 틅`%===@\$$@ɛE$Ό74$4$`D$膍m149FD$D$$F$\v$F$<$DD$葐u$8$!^$p|8D$$耑8D$ $z8D$$t$'$D$؋4@.D$$D$b0upf=\$$4m$諏$D$g$蓏$ؤD$@8$ HD$$D`%<'DP=@EH@8D$D$؉ $=$$D$P8 $V$贎$PD$p$蜎$D$$脎$̥D$랉$o$ D$+@HD$$8D$$x\$$^蔘E=@؉$8e$܍$HD$OD$$xuI8$6=Lt EEe$g=PtEƎюD$$蛮x{,M䉍4D$$ixt(H Pȃ ȃ  @D$v$xt+P@ D$T$ D$8$IEuaD$$ޭx P8@ D$T$ $D$E$Q$(D$$9$D$$!$D$8D$`$MxD$`$3p$5}HD$4$tWHD$4$u@ًHD$$8D$$ƕ$`谕E^@4@#4$莌D$$蔇DžDr9>vvu}ԍv FUԉ W t>;:v &9:r JRuV1tEԋtp$r}ԅtTFU FBFfFuYV4$UT$Uԃ$‰\EU BEԃ<[^_]ÉEfE+@qEEt.<$PqD$ $(q<$@qy ǃt.4$pD$ $p4$py ǃ $Ë$ÐUVS.Vt&Ћu[^]Ë$US[+r[US[q[ 2x;FO0W`8 i(t}@Whc Nc!OV=+(v: "0: 6:* d1 8 E O V m` g Dzdn \rCH"  ffioo=B;}     h   G        b    t"   M "K  "      u    i  ln   fn  )  5  ?  C   d K c S r ]  j dx c @n@ g@ f#@t@# id# p  r# t   s#a t# . $9 ? O _ j p w    *        r r r r rUr r r r l# 9  $E n $dR ] $b h{  $g j (%dx  %   d %d <&d t&W  d  &d 'd 2 p'$ 6 `-'I lN n #'V  (b k (w  )  4)  t)d  )e  )   l*  *  4+# +16  +BL x,AE |,Y[  -jL x-nr d-j{ d/ /  80Xb h0b  0d X0 $O (1b 1d1@2<2dF2dXcb 2b 3b H33b F 3d4"  5  6b 3L6) t6).7b A 7dK 8Veu 8p 8d 9d D;d 4<d <dP=b   H>d- >dZ >b T?M t?i ?d, ,@dD, Bb \  BYyv  HCYCd Db  hDd EdEb  tFd Gd Gd hHb  Hb , @ I8D  J T  Kak ' .%sLog size = %zu, max = %zu -%Y%m%d_%H%M%Sstructured-ssn-formatLOG_AUTHPOSIXLY_CORRECT%s: illegal option -- %c %s: option `%s' is ambiguous %s: unrecognized option `%s' jarExample yessha1truefooERROR: Unknown option passed ~%s: Removed. !Can't remove file '%s'. %s/%s%s/%s.%03u!Can't copy file '%s' ~%s: copied to '%s' ~%s: moved to '%s' !Can't move file %s !Can't unlink '%s': %s removecopy0.98.4/usr/local/etc/freshclam.confDatabaseDirectory%s/daily.cvd%s/daily.cldClamAV %s ClamAV %s/%u/%sfile-list/dev/nulldup2(%d, %d) failed Can't open /dev/null %s/*Scanning %s%s!%s (*) Default scan settings log-verbosequietstdoutdebuggen-mdbcvd-versionhelprecursiveinfectedsuppress-ok-resultsbellDevLiblogno-summarydatabaseKnown viruses: %u Engine version: %s Scanned directories: %u Scanned files: %u Infected files: %u Data scanned: %2.2lf MB movedcopiedNot %s: %u Not removed: %u Total errors: %u ERROR: setgid(%d) failed. ERROR: setuid(%d) failed. CL_TYPE_ANY%s:%s...excludeinclude~%s: Empty file archive-verbose*Scanning %s ~%s: Excluded ~%s: Access denied ~%s: OK ~%s: %s ERROR ^Can't open file %s: %s ~%s%s!(%d)%s: %s FOUND ~%s: %s FOUND ~%s!(%d): %s FOUND exclude-dirinclude-dirmax-dir-recursionfollow-dir-symlinksfollow-file-symlinkscross-fs%s: Symbolic link ~%s: Can't open directory. no-phishing-sigsofficial-db-onlyno-phishing-scan-urlstrust-bytecodedisable-cachedisable-pe-statsenable-statsstats-timeoutstats-host-idnon-defaultnoneanonymousdetect-puaexclude-puadev-ac-onlydev-ac-depthleave-tempsforce-to-diskbytecode-unsignedbytecode-statisticsbytecode-timeoutbytecode-modeForceJITForceInterpreterTesttempdirStatsTimeoutinclude-pua!Invalid HostID nocertsdumpcertsmax-scansizemax-filesizemax-filesmax-recursionmax-embeddedpemax-htmlnormalizemax-htmlnotagsmax-scriptnormalizemax-ziptypercgmax-partitionsmax-iconspeallmatchphishing-sslphishing-cloakpartition-intersectionheuristic-scan-precedencescan-archivedetect-brokenblock-encryptedscan-pescan-elfscan-ole2scan-pdfscan-swfscan-htmlscan-mailalgorithmic-detectiondev-performancedetect-structured-^%s: Not supported file type ^%s: Can't access file structured-ssn-countstructured-cc-count/var/lib/clamavwb!Can't write to %s *Checking %s stdin: OK stdin: %s ERROR stdin: %s FOUND !Can't open %s for writing HostID is valid: %s LOG_CRONLOG_DAEMONLOG_KERNLOG_LPRLOG_MAILLOG_NEWSLOG_SYSLOGLOG_USERLOG_UUCPLOG_LOCAL0LOG_LOCAL1LOG_LOCAL2LOG_LOCAL3LOG_LOCAL4LOG_LOCAL5LOG_LOCAL6LOG_LOCAL7^(yes|true|1|no|false|0)$config-file/usr/local/etc/clamd.confno-warningsdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstream/usr/local/share/clamav^[0-9]+$hex-dumpmd5sha256print-certshtml-normaliseutf16-decodebuildmax-bad-sigs3000flevelno-cdiffserverunpackunpack-currentinfolist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffdefaultcolorsconfig-dir/usr/local/etcgenerate-configforce-interpreterprintsrcPrint source code of bytecodeinputtracebytecode trace levelno-trace-showsourcebytecode-trust-allhttp-proxyproxy-userforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$block-maxunzipunrararjunzoolhatartgzdebUpdateLogFile/tmp/clamav.logDetectionStatsHostIDStatsEnabledStatsPEDisabledno3310LogFileUnlockLogFileMaxSize25MLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectory/tmpdatadirOfficialDatabaseOnlyLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocketTCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLengthStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeout15SendBufTimeout200300MaxQueueIdleTimeoutClamukoExcludePath^/proc/ ^/sys/MaxDirectoryRecursionFollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemsSelfCheck600DisableCacheVirusEventExitOnOOMAllowAllMatchScanForegroundDon't fork into background.DebugLeaveTemporaryFilesUserAllowSupplementaryGroupsBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeout5000BytecodeUnsignedBytecodeModeAutoBytecodeStatisticsDetectPUAExcludePUANetTool PWToolIncludePUASpy Scanner RATAlgorithmicDetectionScanPEScanELFDetectBrokenExecutablesScanMailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakPartitionIntersectionHeuristicScanPrecedenceStructuredDataDetectionStructuredMinCreditCardCountStructuredMinSSNCountStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLScanOLE2OLE2BlockMacrosScanPDFScanSWFScanArchiveArchiveBlockEncryptedForceToDiskArchiveMaxScanSize100MClamukoMaxFileSizeMailMaxRecursion16ArchiveMaxFiles10000MaxEmbeddedPE10MMaxHTMLNormalizeMaxHTMLNoTags2MMaxScriptNormalizeMaxZipTypeRcg1MMaxPartitions128MaxIconsPE100ClamukoScanOnAccessOnAccessIncludePath/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeUIDOnAccessMaxFileSizeDevACOnlyDevACDepthDevPerformancedev-liblog/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSubmitDetectionStats/path/to/clamd.confDetectionStatsCountrycountry-codeunique-idSafeBrowsingDisableCertCheckArchiveMaxRecursionArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludeUIDClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipientsWARNING: Log size limit met but log file rotation turned off. Forcing log file rotation anyways. Need to rotate log file due to size but ran out of memory. Need to rotate log file due to size but could not get local time. ERROR: Can't open %s in append mode (check permissions!). WARNING: File locking not supported (NFS?)ERROR: %s is locked by another process %s: option requires an argument -- %c %s: option `--%s' doesn't allow an argument %s: option `--%s' requires an argument ERROR: optaddarg: Unregistered option %s ERROR: optaddarg: strdup() failed ERROR: optaddarg: malloc() failed ERROR: optparse: Can't register new option (not enough memory) ERROR: optparse: longopts[] is too small ERROR: optparse: shortopts[] is too small ERROR: optparse: (short|long)opts[] is too small ERROR: Please edit the example config file %s ERROR: Missing argument for option at line %d ERROR: Missing closing parenthesis in option %s at line %d ERROR: Empty argument for option %s at line %d ERROR: Incomplete option passed (missing argument) ERROR: optparse: No corresponding long name for option '-%c' ERROR: Parse error at line %d: Unknown option %s WARNING: Ignoring unsupported option %s at line %u WARNING: Ignoring unsupported option --%s (-%c) WARNING: Ignoring unsupported option --%s ERROR: Can't register argument for option %s ERROR: Can't register argument for option --%s WARNING: Ignoring deprecated option %s at line %u WARNING: Ignoring deprecated option --%s (-%c) WARNING: Ignoring deprecated option --%s ERROR: optparse: Can't compile regular expression %s for option %s ERROR: Incorrect argument format for option %s ERROR: Incorrect argument format for option --%s (-%c) ERROR: Incorrect argument format for option --%s ERROR: Option --%s (-%c) requires a non-empty string argument ERROR: Option --%s requires a non-empty string argument ERROR: Can't parse numerical argument for option %s ERROR: Can't parse numerical argument for option --%s (-%c) ERROR: Can't parse numerical argument for option --%s WARNING: Numerical value for option %s too high, resetting to 4G WARNING: Numerical value for option --%s (-%c) too high, resetting to 4G ERROR: optparse: calloc failed ERROR: optparse: strdup failed ERROR: Problem parsing options (name == NULL) /usr/local/etc/clamav-milter.confDump authenticode certificate chain.Always generate MDB entries for PE sectionsMaximum number of mismatched signatures when building a CVD. Zero disables this limit.Feature level to put in the CVDVersion number of the CVD to buildForce using the interpreter instead of the JITTrust loaded bytecode (default yes)Load and print bytecode information without executingInput file to run the bytecode nDon't show source line during tracingSave all reports to a log file.HostID in the form of an UUID to use when submitting statistical information. See the clamscan manpage for more information.Enable submission of statistical dataDisable submission of PE section statistical dataTimeout in seconds to timeout communication with the stats server.By default the log file is locked for writing and only a single daemon process can write to it. This option disables the lock.Maximum size of the log file. Value of 0 disables the limit.Log all clean files. Useful in debugging but drastically increases the log size.Use the system logger (can work together with LogFile).Type of syslog messages. Please refer to 'man syslog' for the facility names.Rotate log file. Requires LogFileMaxSize option set prior to this option.Log additional information about the infected file, such as its size and hash, together with the virus name.Save the process ID to a file.This option allows you to change the default temporary directory.This option allows you to change the default database directory. If you enable it, please make sure it points to the same directory in both clamd and freshclam.Only load the official signatures published by the ClamAV project.Path to a local socket file the daemon will listen on.Sets the group ownership on the unix socket.Sets the permissions on the unix socket to the specified mode.Remove a stale socket after unclean shutdownA TCP port number the daemon will listen on.By default clamd binds to INADDR_ANY. This option allows you to restrict the TCP address and provide some degree of protection from the outside world.Maximum length the queue of pending connections may grow to.Close the STREAM session when the data size limit is exceeded. The value should match your MTA's limit for the maximum attachment size.The STREAM command uses an FTP-like protocol. This option sets the lower boundary for the port range.This option sets the upper boundary for the port range.Maximum number of threads running at the same time.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any data.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any initial command after connecting.This option specifies how long to wait (in miliseconds) if the send buffer is full. Keep this value low to prevent clamd hanging.Waiting for data from clamd will timeout after this time (seconds).Maximum number of queued items (including those being processed by MaxThreads threads). It is recommended to have this value at least twice MaxThreads if possible. WARNING: you shouldn't increase this too much to avoid running out of file descriptors, the following condition should hold: MaxThreads*MaxRecursion + MaxQueue - MaxThreads + 6 < RLIMIT_NOFILE (usual max for RLIMIT_NOFILE is 1024) This option specifies how long (in seconds) the process should wait for a new job.Don't scan files/directories whose names match the provided regular expression. This option can be specified multiple times.Maximum depth the directories are scanned at.Follow symlinks to regular files.Scan files and directories on other filesystems.This option specifies the time intervals (in seconds) in which clamd should perform a database check.This option allows you to disable clamd's caching feature.Execute a command when a virus is found. In the command string %v will be replaced with the virus name. Additionally, two environment variables will be defined: $CLAM_VIRUSEVENT_FILENAME and $CLAM_VIRUSEVENT_VIRUSNAME./usr/bin/mailx -s "ClamAV VIRUS ALERT: %v" alert < /dev/nullStop the daemon when libclamav reports an out of memory condition.Permit use of the ALLMATCHSCAN command.Enable debug messages in libclamav.Don't remove temporary files (for debugging purposes).Run the daemon as a specified user (the process must be started by root).Initialize a supplementary group access (the process must be started by root).With this option enabled ClamAV will load bytecode from the database. It is highly recommended you keep this option on, otherwise you'll miss detections for many new viruses.Set bytecode security level. Possible values: TrustSigned - trust bytecode loaded from signed .c[lv]d files, insert runtime safety checks for bytecode loaded from other sources Paranoid - don't trust any bytecode, insert runtime checks for all Recommended: TrustSigned, because bytecode in .cvd files already has these checks.Set bytecode timeout in miliseconds.Allow loading bytecode from outside digitally signed .c[lv]d files.^(Auto|ForceJIT|ForceInterpreter|Test)$Set bytecode execution mode. Possible values: Auto - automatically choose JIT if possible, fallback to interpreter ForceJIT - always choose JIT, fail if not possible ForceIntepreter - always choose interpreter Test - run with both JIT and interpreter and compare results. Make all failures fatal.Collect and print bytecode execution statistics.Detect Potentially Unwanted Applications.Exclude a specific PUA category. This directive can be used multiple times. See http://www.clamav.net/support/pua for the complete list of PUA categories.Only include a specific PUA category. This directive can be used multiple times.In some cases (eg. complex malware, exploits in graphic files, and others), ClamAV uses special algorithms to provide accurate detection. This option controls the algorithmic detection.PE stands for Portable Executable - it's an executable file format used in all 32- and 64-bit versions of Windows operating systems. This option allows ClamAV to perform a deeper analysis of executable files and it's also required for decompression of popular executable packers such as UPX or FSG. If you turn off this option, the original files will still be scanned, but without additional processing.Executable and Linking Format is a standard format for UN*X executables. This option allows you to control the scanning of ELF files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled clamav will try to detect broken executables (both PE and ELF) and mark them as Broken.Executable.Enable the built in email scanner. If you turn off this option, the original files will still be scanned, but without parsing individual messages/attachments.Scan RFC1341 messages split over many emails. You will need to periodically clean up $TemporaryDirectory/clamav-partial directory. WARNING: This option may open your system to a DoS attack. Please don't use this feature on highly loaded servers.With this option enabled ClamAV will try to detect phishing attempts by using signatures.Scan URLs found in mails for phishing attempts using heuristics.Always block cloaked URLs, even if they're not in the database. This feature can lead to false positives.PhishingAlwaysBlockSSLMismatchAlways block SSL mismatches in URLs, even if they're not in the database. This feature can lead to false positives.Detect partition intersections in raw disk images using heuristics.Allow heuristic match to take precedence. When enabled, if a heuristic scan (such as phishingScan) detects a possible virus/phish it will stop scan immediately. Recommended, saves CPU scan-time. When disabled, virus/phish detected by heuristic scans will be reported only at the end of a scan. If an archive contains both a heuristically detected virus/phish, and a real malware, the real malware will be reported. Keep this disabled if you intend to handle "*.Heuristics.*" viruses differently from "real" malware. If a non-heuristically-detected virus (signature-based) is found first, the scan is interrupted immediately, regardless of this config option.Enable the Data Loss Prevention module.This option sets the lowest number of Credit Card numbers found in a file to generate a detect.This option sets the lowest number of Social Security Numbers found in a file to generate a detect.With this option enabled the DLP module will search for valid SSNs formatted as xxx-yy-zzzz.With this option enabled the DLP module will search for valid SSNs formatted as xxxyyzzzzPerform HTML/JavaScript/ScriptEncoder normalisation and decryption. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning of OLE2 files, such as Microsoft Office documents and .msi files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled OLE2 files with VBA macros, which were not detected by signatures will be marked as "Heuristics.OLE2.ContainsMacros".This option enables scanning within PDF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning within SWF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.Scan within archives and compressed files. If you turn off this option, the original files will still be scanned, but without unpacking and additional processing.Mark encrypted archives as viruses (Encrypted.Zip, Encrypted.RAR).This option causes memory or nested map scans to dump the content to disk. If you turn on this option, more data is written to disk and is available when the leave-temps option is enabled at the cost of more disk writes.This option sets the maximum amount of data to be scanned for each input file. Archives and other containers are recursively extracted and scanned up to this value. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage.Files/messages larger than this limit won't be scanned. Affects the input file itself as well as files contained inside it (when the input file is an archive, a document or some other kind of container). The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Nested archives are scanned recursively, e.g. if a Zip archive contains a RAR file, all files within it will also be scanned. This option specifies how deeply the process should be continued. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Number of files to be scanned within an archive, a document, or any other container file. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.This option sets the maximum size of a file to check for embedded PE. Files larger than this value will skip the additional analysis step. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a HTML file to normalize. HTML files larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a normalized HTML file to scan. HTML files larger than this value after normalization will not be scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a script file to normalize. Script content larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a ZIP file to reanalyze type recognition. ZIP files larger than this value will skip the step to potentially reanalyze as PE. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of partitions of a raw disk image to be scanned. Raw disk images with more partitions than this value will have up to the value number partitions scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of icons within a PE to be scanned. PE files with more icons than this value will have up to the value number icons scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option enables on-access scanning (Linux only)This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times.With this option you can whitelist specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line).Files larger than this value will not be scanned in on access.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net for IPv6) and database.clamav.net (in this order). Please replace XY with your country code (see http://www.iana.org/cctld/cctld-whois.htm). database.clamav.net is a round-robin record which points to our most reliable mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net database.clamav.netThis option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Download an additional 3rd party signature database distributed through the ClamAV mirrors. This option can be used multiple times. Here you can find a list of available databases: http://www.clamav.net/download/cvd/3rdpartyWith this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downlading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.When enabled freshclam will submit statistics to the ClamAV Project about the latest virus detections in your environment. The ClamAV maintainers will then use this data to determine what types of malware are the most detected in the field and in what geographic area they are. Freshclam will connect to clamd in order to get recent statistics.Country of origin of malware/detection statistics (for statistical purposes only). The statistics collector at ClamAV.net will look up your IP address to determine the geographical origin of the malware reported by your installation. If this installation is mainly used to scan data which comes from a different location, please enable this option and enter a two-letter code (see http://www.iana.org/domains/root/db/) of the country of origin.This option enables support for our "Personal Statistics" service. When this option is enabled, the information on malware detected by your clamd installation is made available to you through our website. To get your HostID, log on http://www.stats.clamav.net and add a new host to your host list. Once you have the HostID, uncomment this option and paste the HostID here. As soon as your freshclam starts submitting information to our stats collecting service, you will be able to view the statistics of this clamd installation by logging into http://www.stats.clamav.net with the same credentials you used to generate the HostID. For more information refer to: http://www.clamav.net/support/faq/faq-cctts/ This feature requires SubmitDetectionStats to be enabled.This option enables support for Google Safe Browsing. When activated for the first time, freshclam will download a new database file (safebrowsing.cvd) which will be automatically loaded by clamd and clamscan during the next reload, provided that the heuristic phishing detection is turned on. This database includes information about websites that may be phishing sites or possible sources of malware. When using this option, it's mandatory to run freshclam at least every 30 minutes. Freshclam uses the ClamAV's mirror infrastructure to distribute the database and its updates but all the contents are provided under Google's terms of use. See http://www.google.com/transparencyreport/safebrowsing and https://github.com/vrtadmin/clamav-faq/blob/master/faq/faq-safebrowsing.md for more information.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/var/run/clamd/clamd.socket The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally orignated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delievery Reject: immediately refuse delievery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delievery; Reject: immediately refuse delievery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delievery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be whitelisted. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.!'%s' doesn't exist or is not a directory ERROR: This tool requires libclamav with functionality level %u or higher (current f-level: %u) ERROR: --file-list: Can't open file %s Clam AntiVirus Scanner %s By The ClamAV Team: http://www.clamav.net/team (C) 2007-2009 Sourcefire, Inc. --help -h Print this help screen --version -V Print version number --verbose -v Be verbose --archive-verbose -a Show filenames inside scanned archives --debug Enable libclamav's debug messages --quiet Only output error messages --stdout Write to stdout instead of stderr --no-summary Disable summary at end of scanning --infected -i Only print infected files --suppress-ok-results -o Skip printing OK files --bell Sound bell on virus detection --tempdir=DIRECTORY Create temporary files in DIRECTORY --leave-temps[=yes/no(*)] Do not remove temporary files --database=FILE/DIR -d FILE/DIR Load virus database from FILE or load all supported db files from DIR --official-db-only[=yes/no(*)] Only load official signatures --log=FILE -l FILE Save scan report to FILE --recursive[=yes/no(*)] -r Scan subdirectories recursively --allmatch[=yes/no(*)] -z Continue scanning within file after finding a match --cross-fs[=yes(*)/no] Scan files and directories on other filesystems --follow-dir-symlinks[=0/1(*)/2] Follow directory symlinks (0 = never, 1 = direct, 2 = always) --follow-file-symlinks[=0/1(*)/2] Follow file symlinks (0 = never, 1 = direct, 2 = always) --file-list=FILE -f FILE Scan files from FILE --remove[=yes/no(*)] Remove infected files. Be careful! --move=DIRECTORY Move infected files into DIRECTORY --copy=DIRECTORY Copy infected files into DIRECTORY --exclude=REGEX Don't scan file names matching REGEX --exclude-dir=REGEX Don't scan directories matching REGEX --include=REGEX Only scan file names matching REGEX --include-dir=REGEX Only scan directories matching REGEX --bytecode[=yes(*)/no] Load bytecode from the database --bytecode-unsigned[=yes/no(*)] Load unsigned bytecode --bytecode-timeout=N Set bytecode timeout (in milliseconds) --bytecode-statistics[=yes/no(*)] Collect and print bytecode statistics --detect-pua[=yes/no(*)] Detect Possibly Unwanted Applications --exclude-pua=CAT Skip PUA sigs of category CAT --include-pua=CAT Load PUA sigs of category CAT --detect-structured[=yes/no(*)] Detect structured data (SSN, Credit Card) --structured-ssn-format=X SSN format (0=normal,1=stripped,2=both) --structured-ssn-count=N Min SSN count to generate a detect --structured-cc-count=N Min CC count to generate a detect --scan-mail[=yes(*)/no] Scan mail files --phishing-sigs[=yes(*)/no] Signature-based phishing detection --phishing-scan-urls[=yes(*)/no] URL-based phishing detection --heuristic-scan-precedence[=yes/no(*)] Stop scanning as soon as a heuristic match is found --phishing-ssl[=yes/no(*)] Always block SSL mismatches in URLs (phishing module) --phishing-cloak[=yes/no(*)] Always block cloaked URLs (phishing module) --partition-intersection[=yes/no(*)] Detect partition intersections in raw disk images using heuristics. --algorithmic-detection[=yes(*)/no] Algorithmic detection --scan-pe[=yes(*)/no] Scan PE files --scan-elf[=yes(*)/no] Scan ELF files --scan-ole2[=yes(*)/no] Scan OLE2 containers --scan-pdf[=yes(*)/no] Scan PDF files --scan-swf[=yes(*)/no] Scan SWF files --scan-html[=yes(*)/no] Scan HTML files --scan-archive[=yes(*)/no] Scan archive files (supported by libclamav) --detect-broken[=yes/no(*)] Try to detect broken executable files --block-encrypted[=yes/no(*)] Block encrypted archives --nocerts Disable authenticode certificate chain verification in PE files --dumpcerts Dump authenticode certificate chain in PE files --max-filesize=#n Files larger than this will be skipped and assumed clean --max-scansize=#n The maximum amount of data to scan for each container file (**) --max-files=#n The maximum number of files to scan for each container file (**) --max-recursion=#n Maximum archive recursion level for container file (**) --max-dir-recursion=#n Maximum directory recursion level --max-embeddedpe=#n Maximum size file to check for embedded PE --max-htmlnormalize=#n Maximum size of HTML file to normalize --max-htmlnotags=#n Maximum size of normalized HTML file to scan --max-scriptnormalize=#n Maximum size of script file to normalize --max-ziptypercg=#n Maximum size zip to type reanalyze --max-partitions=#n Maximum number of partitions in disk image to be scanned --max-iconspe=#n Maximum number of icons in PE file to be scanned --enable-stats Enable statistical reporting of malware --disable-pe-stats Disable submission of individual PE sections in stats submissions --stats-timeout=#n Number of seconds to wait for waiting a response back from the stats server --stats-host-id=UUID Set the Host ID used when submitting statistical info. (**) Certain files (e.g. documents, archives, etc.) may in turn contain other files inside. The above options ensure safe processing of this kind of data. !Can't parse command line options # ------------------------------------------------------------------------------- !Problem with internal logger. ----------- SCAN SUMMARY ----------- Data read: %2.2lf MB (ratio %.2f:1) Time: %u.%3.3u sec (%u m %u s) !scandirs: Memory allocation failed for fname !--follow-dir-symlinks: Invalid argument !--follow-file-symlinks: Invalid argument !Can't initialize libclamav: %s !Can't initialize antivirus engine !Can't allocate memory for pua_cats !--exclude-pua and --include-pua cannot be used at the same time !cli_engine_set_str(CL_ENGINE_PUA_CATEGORIES) failed: %s !cli_engine_set_str(CL_ENGINE_TMPDIR) failed: %s !Database initialization error: %s !cli_engine_set_num(CL_ENGINE_MAX_SCANSIZE) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_FILESIZE) failed: %s ^System limit for file size is lower than engine->maxfilesize ^System limit for file size is lower than engine->maxscansize ^Cannot obtain resource limits for file size !cli_engine_set_num(CL_ENGINE_MAX_FILES) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_RECURSION) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_EMBEDDEDPE) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_HTMLNORMALIZE) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_HTMLNOTAGS) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_SCRIPTNORMALIZE) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_ZIPTYPERCG) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_PARTITIONS) failed: %s !cli_engine_set_num(CL_ENGINE_MAX_ICONSPE) failed: %s !Invalid argument for --structured-ssn-format !cli_engine_set_num(CL_ENGINE_MIN_SSN_COUNT) failed: %s !cli_engine_set_num(CL_ENGINE_MIN_CC_COUNT) failed: %s !Can't get absolute pathname of current working directory !Can't write to temporary directory !Can't generate tempfile name ^Only scanning files from --file-list (files passed at cmdline are ignored) 5b585e8f-3be5-11e3-bf0b-18037319526c:L...... //*/:/J/Z/j/z///////// 00*0:0J0Z0j0z000000000 11*1:1J1Z1j1z111111111 22*2:2J2Z2j2z222222222 33*3:3J3Z3j3z333333333 44*4:4J4Z4j4z444444444 55*5:5J5Z5j5z555555H       - @ J t   @ `V V H e  `H``` )`oo&o**o``>`zR|0 ( AB E AA B $HAB EAA <p@ AB F AAA H O EAA A <_AB INHS AB x AA *AB f $ BAB FFq A,8pKAB FL AA h*AB f  3AB AmA <0AD FFNO AA  AA  1AB DhA ,`)AB C> AAA A @T5d@XMXMH H&' ) * * . 5 @`\`L` @ !"#$%&'())  _ : * Vp  nP* P3 1 B оK -@U `gs 7 @D7 H)2?@JB P\QU epQ lS v`lM l  m pn į %  8 = E0 N6 Wh  z@3  @ h PH  b  L 6p Rc ep' v @ @Ю    x    h ! (@ / 6 =P D Kо R  YP ` g n u | X Į.3ET 42 31&4ChM3h5"v.{/zxl2.\44t//341f (4:̮ELt0T0[3g0mrtD `%D2r  1d/4L2t | $0T5$`-2:|H$1T5 [/b`x7F @8T3  y `|6v pp @ 2D0 4 D1 ) t3. 2: L 5S @;7 Ȯ^ F h 2%4r 0V { } ~ 3 @x T/ 1 1 2 d3 2S/ 1 `d0 UU 0  v  1" d4^14 `o  = T2B D3 v  K `R 45Y 3a d1l 2Bt5. D/ `U  0yk T0 0> 0  P1 4/ 6  d 3 .  $3$ 5u.* 02 /< 40E T4W $2%`!b 50t 0{ f 5"  / $4 t4 pD 0 5" 41 ;  4  j . 7 d2/2< 43D pN t1V ] $5x t @ D4 4 3 4   t2 0 // 3  h@- y. 2 4/ 19 5"L 0S $/Z T1b P1 v D5 d5 1clamscanfsr.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__fsr_init_value_ptrtrap_tablecrti.svalues-Xa.cDrodata.rodatacrtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.5017dtor_idx.5019frame_dummyobject.5029output.cfacilitymapgetopt.ccharind.2952_getopt_internaloptparser.coptget_ioptaddoptaddargactions.caction_removegetdesttarglenactargetaction_copyaction_movemisc.ccnt.17280fs.17282buff.17279clamscan.cmanager.cprecheckaccessprint_chain.clone.0.clone.1cl_engine_set_clcb_metapostcl_scanfilescandirsunwind-dw2-fde.c__gthread_trigger__gthread_activefde_unencoded_compareframe_downheapframe_heapsortsize_of_encoded_valueread_encoded_value_with_baseget_cie_encodingbase_from_object.clone.3classify_object_over_fdesfde_single_encoding_comparelinear_search_fdesadd_fdes.clone.4search_objectfde_mixed_encoding_comparemarker.6396object_mutexunseen_objects__gthread_active_mutex.6172__gthread_active_once.6173.L45.L39.L40.L46.L37.L43.L44.LFB55.LFB56.LFB66.LFB37.LFB38.LFB39.LFB40.LFB41.LFB42.LFB43.LFB45.LFB67.LFB75.LFB76__CTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrtn.s_END__Unwind_Find_FDE__DTOR_END____dso_handle__deregister_frame_info_bases_START___register_frame_info_bases__register_frame_info_table__deregister_frame_info__register_frame_info__register_frame_table__deregister_frame__register_frame__register_frame_info_table_basesopterrstrlenfputclogg_facilitycli_ctimereallocstrpbrknotmovedcl_engine_set_clcb_pre_cachelogg_timecl_always_gen_section_hashpthread_once_exitcli_chompmprintf_verbosemprintf_disabledlogg_rotatecl_cvdhead__fpstartlogg_syslogcl_engine_set_clcb_stats_get_hostidfputs___errnolstat64getrlimitatoioptadditemcl_engine_compileprintcleanactionfilenofprintfcl_strerrorfgetsbellcheck_flevelmprintf_send_timeout__iobcl_retflevelprint_version__1cG__CrunMdo_exit_code6F_v_fopencloselogcl_engine_stats_enable_DYNAMICsigemptysetfileliststrcpyfread_environgettimeofdaymprintf_quietcli_regcomp_startfflush_GLOBAL_OFFSET_TABLE_mdprintf_edata__clam_optionssetgid_Jv_RegisterClassescli_is_abspath_fini__fsrget_versionscanmanagervsnprintfrename_lib_versionclosedircli_regfree__fsr_init_valuewaitsigprocmask__longdouble_usedperrorlogg_closemy_getoptsigaddsetoptparsemainmprintf_stdoutcl_cleanup_cryptomatch_regexfclosebasenameunlinkstrncpysetuidcli_filecopycl_retdbdirlogg_fpoptgetgetenvmprintf_nowarndaemonizestrchrcl_engine_set_stractsetupdup2getpwnam_etextgetcwdopendirstrcasecmpcl_initialize_cryptooptfreeprintinfectedcountlinesumaskloggfcntlnotremovedmy_getopt_longcl_engine_get_num_mcountis_valid_hostidlogg_verbosereaddiratexit___Argvcl_debugabortstrncmprecursionstrftimecl_engine_set_numcl_cvdfreecli_sigperf_printcalloclogg_nowarn_get_exit_frame_monitoroptargsendcl_engine_newcl_loadfreshdbdirlocaltime_rpthread_mutex_unlockcli_regexecmprintfcl_initoptindlogg_noflush_PROCEDURE_LINKAGE_TABLE_forkgeteuidlogg_sizestrtouloptoptcli_sigperf_events_destroylogg_filecl_engine_freecl_engine_set_clcb_stats_submitcl_scandesc_callbackcl_engine_set_clcb_post_scanlogg_locklogg_foregroundsetsidstrdupfwritememcpy_end__environ_lockhelpmallocpthread_mutex_lockstrcmpselectstrrchrmy_getopt_long_onlycli_gentempcli_gettmpdirsprintfGCC: (GNU) 4.5.2ld: Software Generation Utilities - Solaris Link Editors: 5.11-1.2329% : ; I I$ >  : ;  : ; I8  : ; I 8 $ >   I : ;I  : ;  I !I/  : ; : ;I8 &I : ; (  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ;' I 4: ;I.? : ; ' I@: ; I : ; I 4: ; I4: ; I 4: ; I! U" U#4: ; I $!I/%.? : ;' @&.? : ;' @': ;I (4: ;I)4: ;I*4: ;I +.? : ;' I@,4: ;I -1RUX Y.41 /1RUX Y0411 2: ;I 34: ; I? < 44: ; I?  % $ > $ > : ; I I: ;I : ;  : ; I8 : ; I 8 : ; I8 &I .? : ; ' I@ : ; I 4: ; I 4: ; I4: ; I : ;  U4: ; I.: ; ' I@: ; I U.? : ;' I@: ;I 4: ; I? < I!I/ 4: ;I?  % $ > : ; I : ;  : ; I8  : ; I 8 $ >  I &I : ; I8  : ;  <  : ; ( I!I/ .: ;' I@: ;I: ;I : ;I 4: ;I4: ;I.? : ;' I@.? : ;' @4: ;I !I/: ;I4: ;I 4: ;I 4: ; I? < 4: ;I? < 4: ; I!4: ; I?  "4: ;I?  % $ > $ > : ; I I: ;I : ;  : ; I8 I !I/  : ; : ;I8 &I : ; I8 .: ; ' I 4: ; I.: ; ' @: ; I .: ; ' I@: ; I4: ; I4: ; I4: ; I .? : ; ' I@1RUX Y  U41 ' I4: ; I? < 4: ; I?  % $ > : ; I : ;  : ; I8  : ; I 8 $ >  I : ;I I !I/ &I : ; I8  : ; : ;I8  : ;I8  : ; ( !I/ : ; < .? : ; ' I .1@ .? : ; ' I@4: ; I4: ; I U.? : ; ' @: ; I .? : ; ' I@: ; I 4: ; I !4: ; I "4: ;I #4: ;I$.? : ;' I@%: ;I &4: ;I'4: ;I (4: ;I ).? : ;' I@ *4: ; I? < +4: ; I% $ > $ > : ; I I: ;I : ;  : ; I8  : ;  I !I/ &I  : ; (  : ; I8 .? : ; ' @.? : ; ' I@: ; I 4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I4: ; I? < 4: ; I?  % $ > : ; I : ;  : ; I8  : ; I 8 $ >  I  I !I/ : ;I  : ; : ;I8  : ; : ; I&I : ; I8  : ; (  : ; ' II'  : ;  : ;I8 < !I/<  : ; : ;  : ; I!.: ; ' I ": ; I#4: ; I$ %.: ; ' I@ &: ; I ': ; I (4: ; I ).: ; ' I@*: ; I+4: ; I,4: ; I -.1@.1/4101 1 U24: ; I 34: ; I44: ; I5.: ; ' @6 74: ;I 84: ;I9 :4: ;I;.: ;' @<: ;I=: ;I >: ;I ?.: ;' I @: ;IA4: ;IB4: ;IC.? : ;' I@D4: ;I E UF1RUX YG41 H.? : ;' I@ I4: ; I? < J4: ; I?  % $ > : ; I$ >   : ; : ;I8 I !I/  : ; : ;I  : ; : ;I : ; (  : ; : ;  : ; I8  I&!I&I : ;  : ; I : ;  : ; I 8  : ; I : ; I8 : ; I' II .: ; ' I !: ; I".: ;' #: ;I$.: ;' I %: ;I&4: ;I' (4: ;I): ; I*4: ; I+ ,.? : ; ' I -.: ; ' @ ..: ;' I@/: ;I 0.: ;' @1: ;I2: ;I34: ;I4 U5: ;I 6.: ; ' I@7: ; I8: ; I9: ; I : : ; ;4: ; I <4: ; I= >4: ; I?1X Y @1A1B C41D4: ; IE4: ;I F1X YG41H1RUX YI.1@J4: ;IK UL1X YM41 N1RUX YO1 P.? : ; ' @Q: ; I R1RUX Y S1RUX Y T.? : ; ' I@U : ; V.? : ;' I@W : ;X4: ; I Y5I 7FQ]0`:{L #! ## #$# %# '# ( # ) # * # + # , # int r!3+.CA?K3FHL XR%T^Ef # /+y 0 P :  < H   *H  ^  c  f      H  H #o $:# %H# ;F + ,:# -# tm$ ?-# @#* A#1 B#9 C# A D#H E#P F#X G#` H# i oHp sH# HX i t- Hs  H  H  : y#s###"# # ! #$"#(##,$Z#4&o#<'o#D(o#L.#T/#X0#`1c#p $p#p#"O#*O#0# 8.#># H/  :F  L: &&DPcu 1BTep|!.>J\k~ !-:GSbqmW 2,#4F#idxw# 9w# Aw#Uw# & b/40F#o1#tsbQָ=t:tmp٣8sb 76;G strFeDG zd ret8 len=! = i=d pt" #tvzX"HX~ :X $%@;w;&;%>+ 'strF(ep)fd1'*G {(E()len=""`(={)i=)pt+{<0>E2 'str<F(>ev*? u(?-(?*@:\)lenA= (Be ,flD!x (K= )iK= )ptK< -(?am ".,~/A"0O 0x 0 ."(: 1?@*6 : $+!xEFU 24xF)iz A ;3/ 350p3B0p3N0p3X0p3 0p3b0p3n1O3x2F35p3?p3?p3?p3?p3?p3?p  2`  7    3 W13 Yp 5 *$ 5G % 3/ 45Ypd4BYpf4NYp4XYph4 Ypj4bYpl4nZOp4x[Ft4]p\4`px4`pz4`p|4ap4ap~4ap4 W1`4 Yp~0 FQ3{Tint.rf C O%3 ?kS A#!S##S#$O# %O# '%# (% # )% # *% # +% # ,% # OO '4(#V )A#*# val+A#  3A ^ 7A F9J  h 7A m 7 v 7{ 9 :As; <3w  <3 off=A opt=A&  hF(tmpuv ivA'jvAkvA|v A@JPh A { + J   A3i 3 AoptAZHtmpviAjAkAh A" Ag AindA AcA Y APPNmh A{      APQh A{      v A$ A+ A%;/  ?v @A$ @AĮ+ @A/ W t2 QTl{7 #!###$# %# '# ( # ) # * # + # , # intr.C,?K3T^Ef % Vo %H 0)!4*V# cmd+V#R ,V#Z - # a .#s /#} 0# idx1#  2!#$ 3!#( 5c#,zJ 0849i# :i# ;%# <#  =i#Z > #R ?i#} @#  A#$ Bi#( Ci#, ./# 0# 1i# 2#  3 &DPcu 1BTep|!.>J\k~ !-:GSbqm- n, n#4 i# idx 6# 9 6# A 6#U 6#~O  '4 (i#V )# *t# val +#  3!QeQv 3!43iB TpQR`v T T4TicmdTiR TiZ T } TidxT V! !! ST4:v !4iR iZ  pt!h!new!G+ )xUUUexv )x4)i~ z2 `U0Vv ! h!5a!Si: !0Vf C ih { c: K T s !fs[  ptVa4iargi i-errYlc,scZd n ret v !X !Topt!  zV@!  k  ~ "@Z  !Y  "z " '% ~ w% ws |!fTl#] 4|iarg|i#:|K | T |s }!i$err$sclcn retb%v !\ !Xopt!%V% "DZ  &Y  &z #'[  N',m ;/]  ?V @ 2  `     ' *~ A   ' /]  TV U!~ AB @ " ' Ȯc `ljp{intr!3L.3LATf #/Ly0sP%z<S ^c:fS#A$ #%S#; S\ : Sl : %| : S : y # L# # # #  # !#$ "#( #\#, $Z#4 &A#< 'A#D (A#L .#T /#X 0l#` 1|#p %H 0)Q4*#cmd+#R ,#Z -L# a .,#s /,#} 0,#idx1,#  2Q#$ 3Q#( 5#, |,zsb} s`ll' s 2,lm( 2q( 2( 3( 3(fd4, )i4,)) dmanH)X d elfdf,) QpnUo) Q RlfdS,) S,"* ,`ojpN*v  ,*^oo~   ( : :*-., *( +: +:  ppy{7 #!###$# %# '# ( # ) # * # + # , # intr.C,?K3T^Ef %  ( (V   %H 0)P4*V# cmd+V#R ,V#Z - # a .#s /#} 0# idx1#  2P#$ 3P#( 5#,. 8 V#? #J #fl# md5V#O V#T V#7 # &DPcu 1BTep|!.>J\k~ !-:GSbq m % .  /# 0# 1# 2#    3V , #4 # idx 6# 9 6# A 6#U 6#  \ <ppvpth FVpr*Dd1H$S+d2H$~+v IP+optJD+t K+z LVO, TVm,J  wrt,t ws yV - yVN-ptz- {$- |o- }. tt. tv.sv Derr s!cntįoptDj/!fslen/ % vv/src  v6x 0 "fdsT#i|0#pidc0$ .@x y0% .% ."reg0P& 1L1'} 1(32{ %) F y.yt% F$ O0yy_1 % O#fhQ1(Rw& S1 ,- ;*/  J 2+ `U : *j  + u Z */   yq{intr.3T^E3f % *HH+,#-# 1 2# : : 3v % &DPcu 1BTep|!.>J\k~ !-:GSbqmB,B#4#idxV# 9V# AV#UV# R : J :#* :#0 :#/ :# 6 :#> o#= o#H 0 )h4 *v#cmd +v#R ,v#Z -A# a .,#s /,#} 0,#idx 1,#  2h#$ 3h#( 5#,E y}1J ?,}2Rh ?,{ ?dsA,2dmsA,2retA,3mbBnrmbBnP3t1Ctt2CtO Etv Gh{3optHR3X  3m :2 `x ]  :  }\ "Ra #Ok #Op $O~ $O5 0Ox 2 ?O ?O ?O : :\ ;R@a  #= #<Zcnw       (0<EP\it~ !i^-AXp     &B]u(C[t}ܨ ;Qfmd5#len(#w(##   7 n ! 4O U t n F   nn m   yn r   nn y# ) I ny(I  |[ a | ny( [ ;     M8ېW#sdb#`#j# 9#t### #$#(#0#8#@#D#H#L.#P4#T4#X4#\cdb#`#d  #h3 #lB #pH#tO#xV4#|^#g# #Z  #q##y&#) #*7 #+C #,t #~-#. #/ #bcs2#3#4#5#6^#7#8}#;#<#=#>#?#B#C # DO #"E| #=F # G#H#1I#EJ#YM#gP#  ( / C . q8 #? #J #fl# md5#O #T #7 #&@DPcu 1BTep|!.>J\k~ !-:GSbqmqro}p@# q#r#s#  t#um#KMP>("`pe##elf$#%#&# doc'#(#)#*#+# ,#$ %q./# 0(# 1n# 2#   3q$F#### ###% # 3uCv#Qw#_x#= y# mz#y|#}#~##]cpu###? ##b#b#b#b#osb#b#b#b# b# P @)&07AM1X2#id3#$T4#(Y5#,c6#0l7^#4I8j#8v9p#<~:|#@r;(#D<#H=#L>#P?#T@h#XA#\Bm#`C#dD#hE#lF#pG#tH#xI#|I#+J#5XAdvmMnXp#q#_bnMyN#O#PP$#envQF# R#  (4odp5o#6#7# * 86 4 #!#"###,$#@n%#Te&#sig'# (K#)K#*#"+#+,#4-#=.#K/# 0# b P13X4#]5#c6njU}V#vY#Z##Z## [#[#\#\#\# \#$hm_"#(`G"#Xc#|c#c#c#d##e!#e!#f##*g##4h#Bh#tib#ib#Pj##Wlm#9mb#qo# aDhD#n#x## #,#8#D#P#\#h#t############4# T (̙ ͙#D#%ϩ#+# h   V 4##8(#cvd#  # . 4=HsEu#|v@#4w#7x##M{## T|##(^}#0h~W#4p#<u#@ #D:z3T" ' \F ] ^Zokey[#_'#bc#d(#e(#f(# F0!str1# 2!#len3m#num3m# }4b# 4b# p7  8|#8|#8m#8m# 9# 9#:# ; #ch< #$E=#(>#,? #0@ #4Am#8%Am#:Am#< Am#>,B #@ C #D:C #HJDm#L}Dm#NPE#PXE#`cE#dnF#hGb#l   m !'w J![K #L!#L!#! 8!  # #E!#P"# X"#c"#  #!#$$m#($m#*cnt%m#,&#.n'#0'#4! -" .# /#] 0#0 37" 47"# oG" $ 7b" 8b"# !r" H3^#val9#9#str:#cnt; # G <#,>^##P?^## nos?^##$ep?^##(?^##,@^##0D@^##4En#8En#<$F#@qH#Dd#XM#idN#0O#7P#EQn# tdbRr"#!#i# P# (# P$,P$#4n#idxb# 9b# Ab#Ub# @`$ =$Gh#N#V## n#!^%"c%"str"len#i#na$#n`$%pretW%&fd'}n'k(c%)sU3%* Un>4*Ung4*U4+W%4,retX+X4<-$څ4&.$;5/$Z5/$50$1/$5)6''n'' n' '[''k,na2K'~(c%+}nI63n\6+A6+Gh6+6 %' )"6'&fd''En'k (c% 18(str'~450E7(* n7*Pޫ 7*v ޱ(B8'b3retz83fd8+993iY93opt(x9+En9+:(sb/}2A`$H6܋1(7str2'~83p:9::i9:(;& [6:)<[n ;dev[3:dd]);8^)#<7sb_/~83`C<8a<:optb(<8cC=8 cp=]?l*@P@v (@bAretBBEnBnBB%Bl*B*(Afs$Ai %}*C0@ =e,=v (7ret\:i>8b>8``@8A8 CA8P |A7sb/~8%A7cwd`v8^A8 nB:opt(BD<PEP+:pR D6Ζ+B}Ep+8t hDF).)D.)D.)E1/)7E/*`E/ *E/*cF/$*F/0*FG<*/H* G/T*>G1/`*GHA t,D R:i GCNG,=Q ,, ;I/,I\ "GIa #[Ik #[Ip $[I~ $[7-nI !D-+- Z- 24`e-J- #z-  4-j- %- $IRJ-I/,I\ "GIa #[Ik #[Ip $[I~ $[I !D-JRJ-`" W@ ^int?73{r.T^EL Fwf G7 L (É  8(l#N(a#d(a#|(l#(l#$($#a4 7\(~#(~#  (  (4 ) ')6)#L)\#a)# v) ) )# 7 )!*!=!R!p!!!!!!" " <" U" n" """"""##5#J#_#x#######$ ?$!c$"{$#$$$%$&$' %(%)0%*J%+j%,%-%.%/%0%1%2&3!&4>&5[&6s&7&8&9&:&;&<'=&'>4'F'U'f'y'''5 075 27 7 > 7 @"(@$(#%,#@&/#.u>77u#7#7O#{>.@/u@0@1>5@6#@7#A8# <9#<#45b=i>,A)7+#7,#8-#u2# s?# E#57 V7X#8Y#8Z# k% 8l7#Am78oL8 @##8#? #*8@# LO7L^7fde>)A/ ;Aq%^ IAYA#`A# hA%!obj!f"qA$#|A$#A$AF%obF%pcF&vecH&loI,&hiI,'&iM,&fN(7O(P A) <L!ob :!p!val!*y7*8L*L <n!p!valn*y7*8L* <!fu <!f"AE %ob#|A$#A(A( <%('(A+) &ptr'(7(O "A %ob#At#YA#`A(A(,(A &i,&j,&k,'(A "B7 %ob#At%v1%v2&i1,&i2,( B$B%n #|A$#,(8,"@/ %ob/#|A/$#/,(A1t"A %ob(|A(,+ &p '&p  ^$B~ %ob~%pc~&vec&lo,&hi,'&i,&f(7(&p( <%$@B`0 %ob`%pc`&vecb( <c%(d&loe,&hie,'&ii,&fj(7k(k&pl,cBN )7(${B%m #Bm i$B% #Bm -< 6t.B>%@s/x?/y?(A(BA0B8hH 1obH2AtH/a /lo%/hi%3i%H3j%-I43tmpaI0B@֭I%1obI2AtI5`A3a I3n,J3m%DJ43tmp J6<H7HJQ7 <HLBK6P`K7 <LK7K8pK9val:9ptru2wu47u8s2Zs4%s8S;u<tL=q>tmp?@ALBCMC:MC ZM=(^DtmpxM?'(^@AA8MB(^CLMCWMCbMBDa N.B%5Nm1cieN3augN3p1OEB\(Y=(^= Fد@AOBدCOCOC OF'@AA8OBGLCWBPGbF4@APBGCPG H@AP4GCPG I:QAQ.CR, lQv1obRR2AR$RJATXRJU,RJ <V%RJW SK0[JA[YSJO \wSE7\lLt+1dASLYAS.CM%pS/obM/xM/yMJO TEOlEBOh.6Cc'T1obwT2AT/pcJATJ <%#UJWUK`JAUJ7 UJ U=`pJ@UKJO &V3p'VLtAHVL}A[VIpnVAVAVC!WCdWCWKC WFԴAW=ȴϴC XKM* lC6 XLt A4XHAGX$;91%%f1u.IC6eX1obX1pcXF е A# YA -Y4C. MYC: zYCE Y4 CQ YC[ ZCe 9ZCq YZC} yZM PL5EAZHt5@3AZN*XuAGZ4xCR [C^[Ci<[4Cur[C[C[C[N )A ?\4M PC w\=iC \Nn >A -]A| \]A ]4 C ]FE >Av ]Aj ^A^ ?^AS _^BC ^C ^C ^C 6_C V_M @4@C _H hAA _A _A _A `4C 8`C n`C* `=>C `H7 ˶AU aAI *a4Ca LaF pA jaA a4C aC aC aC &bC Fb4C zbC bC bC bC$ cBŻ 3p :cB 3fXc.WC]%@vc/ob]/x]/y]E<_%PErC_%PE`lEB`hNKbOHtK03OLfOLt3O ;%*;*6;*L;%P}CIOcQ7I(9obIQ7JQ8J RN GH[4pO` ЮHG4C"dMM Ss y`4A KdHy(4HCsdMM PCdPzd9Q7d(9obdPCj¾doQ7jDoblePC{о+eqQ7{9ob{Q7|Q8| RN h4O` ЮH4C{eMM Ss E4A eHE(4HCeMM PC JeQ79obPCP-fQ7DobefTDcfQ7(DpfDobSgUoutPRN h4O` ЮH4CgMM Ss P4A gHP4 ChMM I0 p{;hOB P3DghDQ7ߢ?0 AB hVFDh/pc573obh3fciWWDNN ( 4@ O` ЮHX 4p CiMM =6!3p jNs  {4 A 8jH 4 CpjMM 4 J <%jJ8jL!1AjLt!*3AjXi Y%X\D,X^D-XkD0iЮ ../shared/usr/include/sys/usr/include/usr/include/iso/usr/gcc/4.5/lib/gcc/i386-pc-solaris2.11/4.5.2/include../libclamavoutput.cva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdarg.hint_types.htypes.htime_impl.htime.htime_iso.hselect.hstat.hfcntl.hfiletypes.hmatcher.houtput.hclambc.h7B ) tf < g e gfgyf*h>k! <u<ff u <ufJ/d.-/0sue/gu;/2h =<) ]f#.e-g t0tB.gJhsXC )t tf < =Whef&ht)o <佻փ-g8fwt <K<=Wh~X <L- ) tf < g e gfgqf<g*~xf.;=gY@Y,), X-gt0T"t~tM%s=;g-/mu;YI=6+<u<H׻/ +<gWg%oM:Jw%%M:t#UM+VBXQ.]#qfX5J$pj1 =; fNfXig[91"WgJKsjX=WXI=;3 :I\..W <  .tLf.}=>K<=;zeYI1W0)37>qfXx teY:hN/  eY:>o+!/eu-gfz1NJ;@KI=IAKI=I ../shared/usr/include/usr/include/iso/usr/include/sys../libclamav/regex../libclamavoptparser.cstdio_impl.hstdio_tag.hstdio_iso.hint_types.hoptparser.hregex.hfiletypes.hmatcher.hgetopt.hstdio.hclambc.hunistd.hQ9Kft<{yXJpjZ,0i-/n-= f-=ly;=x@y+=1ng9i 9w u Cy.Y/it0VhX4J\ f=-M׭-= f*iugx/L tgW/jK-=>,>JvfuvtT*$f$'~g9Kft<@ufuʰ=Ku=z. J=mJy w< Khs.[f=f*tAf"<0.Xu>;s{fX<><ucJfa.f;Yh:K~/u?gs׮IggIgfr"o?>)B ȭ~$9u;/i~X t/WX>Hh#*="iU|Oe/}X%Y}f.~X0T==LVg4f<,x~tY-gg)" rJ.ft"?+~t$ef;6~t'-Ykg~$p'NTg-Lot[%X#F#$~$LVgLVg #LVg&#tmyXWXWSXLVg-;#lgWX=W}$$S$@T:$'>V;- y,0./;uJKthb>,0.6its/;uJztK*3=0WKv fv< JvX J^xg=$e/",u  ../shared/usr/include/usr/include/iso/usr/include/sys../libclamav../libclamav/regexmisc.cstdio_impl.hstdio_tag.hstdio_iso.hint_types.htypes.hoptparser.hclamav.hfiletypes.hregex.hmatcher.hclambc.hpp< Y(/^"=Yg/=tn wX(!{ =lt = tw?za0K<p䃃g=;=mZ,>/*<w^.gx*]F%[ڗyfCJ!c u30Vs Xx<`vo/-Yg,o <: =YYYY;=f  J WW>\Z[[:0x`iK-vYu-Yt`'y<>0[.,/.W!=sYvVYk,X`?u!KKKKKYsɻ-f(=W}HrgJY ( /usr/include/usr/include/iso/usr/include/sys../shared../libclamav../libclamav/regexmanager.cstdio_impl.hstdio_tag.hstdio_iso.hstdio.hint_types.htypes.htime_impl.hresource.hstat.hpwd.hdirent.hdirent.hoptparser.hglobal.hclamav.hothers.hfiletypes.hmpool.hdconf.hregex.hclambc.hbytecode_detect.hbytecode.hbignum_fast.hbignum.hcrtmgr.hmatcher.hhashtab.hmatcher-ac.hmatcher-bm.hmatcher-hash.hactions.hLKMDJ.2!b#\֟WNrtb<.g<t(fj-/zJz?hy<ɒJuY2+  &z'K t/;g/X|/;g/|<X|jJgYYYru3VVvu a\u 0Kw<*Y50D*g(3z<".Y}+*+9+9+w)B3 K[׃%uu~tJZ0ugYxggg/g/%%g/Y /Y/Y/Y/Y/Y/Y/Y/}J}.}X>Y>Y>Y>Y>Y>Y>Y>Y>Y>Y>Y>Y>Y>YyCY>'  3r<!!|<-Z:5Xw}Kw<\YY  Kt ~J|tuvu~/0.YV||Rtd/~^ّxH5uYEt HtY(Y+/xtt|t3uWXw!W/$WT|X%*,m =Whcu,Kzȟuj=uf*LVzuW v}3-q<>,]-[v M!WW=?;uey  /builds/hudson/workspace/nightly-update/build/i386/components/gcc45/gcc-4.5.2/libgcc/../gcc/builds/hudson/workspace/nightly-update/build/i386/components/gcc45/build/i86/./gcc/include/usr/include/sys/builds/hudson/workspace/nightly-update/build/i386/components/gcc45/gcc-4.5.2/libgcc/../gcc/config/i386gthr-posix.hunwind-dw2-fde.cunwind-pe.hunwind-dw2-fde.hstddef.hint_types.htypes.hi386.hunwind.h %iH><@[+yH <w. .z<) XuDx<@@8 f^jt;/9?G?+P|!M <uf Jw< Xq[y_r.q< ft <2.N)/ t==q==`g/:x."f]j~jjJ~jjJ <]8t<]nx<x<1e~x<|<<|<|ft||fe=e=ZwmxUYx;KK|Xfl|tf!e}?Jz;/"i>J~;J}<f~<#>[<#t>tg=-=.zfw{f[/ Jr0UY8@/~XiJ}f;}f `< tyt{XK~fw|f[u= txUY{f3+?G R<g.?9?2ofZ=;KzJX~<<Xf'q.YX.~-=}f0utYe=s~fZ=ix~ <w <6x fuJ fxJA}/)  fuJH>>:/F@@8=;=fYf'<Zf-=h=;=I==}<<}Ȫcw==;=W/- tY}=-  0H0jf~<X~<;YMghy:;KM=>:>XJI=<~<<~<<~:>[<m.+? &rf=@7KNv>}>wt$~~w.~~<X~<<Xzffz<<zf~4X,=W?}<,>.fp>=pg=?ff<Kzge=>ph=>Kc;LyfJ<z\Qq*\Q\*SPS *0*KR "R0RR v v?PP P  PX0 0>P> 1 P X WWSaWWRVWWVVRPR !t!#t#ututb u 2P2b X 8R8b L LQLb H`S_xSSSiSiS`I_HRb  `0`Q_xQQ QIe0ezQzQiQ  P_\_x xV 0V PV %0%i?i   G ?Q r  r ? 0  V 0 00 = \= Z 0Z b p #_S0 = SSS Q _WS0 = W#+W+4Q4;P;GQVVQ `  0 viG Q 0 = b 0I0000WG DQ h 0>0FQV Q!Q!%Q%0q0<Q<GQQQVG W` h 00I0000\G \Q h 0 !P%IPPPp q tq t tt t t t t t t t tttTuTUtPSRSRUPRSV`atactc]u]`t`u`vPvP`|R|T`Q\W^WPZS^Stt}u}~t~tuPR\Q{WW$P$=RPR$JRRSSPPttDuDEt S BSBEPPQtQStSu tPw( SSWSs$VS SSkv0 !t!#t#n un o to u t u 0P*k* 0 } k} 0 k 0k0kvS S*V* S ( V 8 V} SI V SVVV;VV"VaVSVPROROVo } R V W ( PPWV~P 0k*k* 0 ( k 8 ko } k} 0 0 P I kI k 0kkVkk"k~kak0kV*W W W 8 W V g W WN0WWtWW;WF00Wv"W~aWW>^0^W0Nv0vkkH0VV,0,DPDVPWwPwP* k V 0 P Po } P} k P kNSVSVP0k  0 1 8 08 W So 0 010K0KP1Py0y~1~01a001 v0vkk N0Nv1vkkQ* P* k*\ } \ \\\ 0*k* 0 } k} 0 k 0k0ka P V P P VV"JPJ~V P  P % P PPPPP*P } P PPP  PRI g    PR F V  Aa  ^  kFtkt kVkk^kk=5*k* 5 K kK R RR } k} 5 k 5k5kttututDu?HVV&&Q0Qtt|0|s*0*DD011;0;@1@0101t0t|1|01D0PWPPPPP@PPT?HTV{T|TTDTV V{VW VW VWD CVWQtVWVWVWVW* *?VW?DVW5h5hpP0P?PczR(R;fPR:P@EREDStt+u+0t0LuLMtPQtQStS6u68t8_u_`t`puPbPPbRb4V7]V`pVhxPxp\~P5W7MW`pWP+P1SpqtqstsutuPVVttrurxtxu).P.qVsV)>0s11ttutut u!&p&VV VttuttuttTuC_P_X'TXPf{P{SSTS~PWWTWNaPaVVV6V68w8TVPPP\T\`atactc5u56t68t8 u  t t(u`00P H (PP-S7S  SP H (PPPd\y\\  \`0*L7dLdy0yLpL0pL 0  L (001t13t3EuEHtHsusttttuttutt%uPW%WHN qNTQTkqkRrR%R03t36t6;t@AtACtCu t ,u,0t0uSSS)SNS0^nS0SPPttuttugqPtt* u* + tP( V0S Stt-u-.t01t13t3uttuttut t utt uW WPP tPVP V t0m r [r t t0PSSPSS S&;P:CPttMuMNtNPtP5u)P)ESO5S)R)BVOZV)Q)KWO5WZ_P_5VBO\\@AtACtCu t *u@gQg*X@q0V$V$*0@q0qQWQQ$W$*0hPP01t18t8{u{tudqRpv"#&VVPo~|P~&PPBcPttuttruttut u tRuRStSP uPSS OSSP SRWoW W QW WQV}}0o0oPWS0S]P]W 0 PP W5APA}S}PP }0 00VPVVV P R#V#AVV\\m" \- P \\\\\} P \?jP0P Q tQ S tS u t u t u t uP | P| S S S SP | R| ~P | Q| ~P b b ~  ~  " ~" 4 4 ~L b Pb ~ ~v P rv  P ~ P ~ P ~ " ~4 ~ 0 0 P W W W P b W W W W" 4 W% + P+ ~ ~? C PC ~ ~ t t u t t "u"#t#(t(\'uSSPWtQtQ)8SS P% . Q Q Q!!Q 0 000VVVV3V3OVOkVkVVVVVV2V2NVNmVmV% 0% Q Q 0 !!!0! " "8"08""!####0#$$$$$V$$V$\' 0 T0TXPXRRRR  $R$\' 1 P \' 1 1P\'*P*\'(?P?RS!!S 0 0PW,P,MW0WUW0.00WPWWWdPd}W W#PPVMV%0P@NP.8PrPVV4@PVP[VPPVPWjP'P`rPPP/APtPPPCOP0V0}V V""P1#=#Pr##P`P`v.4P4P.VV#S$$\'#K$S$:%S:%%%%S%&&'S'\'#S$$\'0&K&PK&&W'\'W#K$0$:%0:%f%f%l% p"l%% s"%%0%% s"%&&'0'\' X:"v"X""XK$S$XL&a&X&&X'G'XG'\'X $K$V$ %V%%P#K$X$L&Xa&&X&&X&'XG'\'X %%P%%V%\'Vd%l%Pl%%S%%S%%P$%:%P:%%W%%W%%t%0&W&&P&&0''P''t''t';(u;(<(t<(H(tH(W(uW(X(tX(`(t`(j(uj(k(tk(l(t #t#Rt RSt`atactcutu`qPqh`RdqlVllxWVWVwP !t!#t#ut 4P4h .R.d=FPFl=F#FiWitwADvDaVadvdiViWtwW#ttut u tu t 'u'(tP%P01t15t5uttxu0>P0QRQxT0PP>>FPFNNSPS^^cPcssxPQQQ>FXKSQ[cQpspsxp|PPQqyQppWW>FXPFPQ qy AQ pFpFXcnnsPsxp|ttutZuZ`t`iuiptpuPV vvjVp v v #VBJVjv PP.P.6r6At "BSP[ePjsPsyPypPPppPPjsPsypyp~ppjvRvyp~yp}PPppP PsyPyPppRvypypttutututuPtt)u)0t0Lu!P!LX R V'V*LVP0PYQ\\P0LLP0inPnTTT*LTP0|PPPP*LPPYQ QPRPV  V*LVVPQtQStSuty}P}Wtt0u08t8BuBCtPC\RPV]cVc.V.1P1:V909]T]mTQ1T WP/W1AWPPCPQ9ClFUPUCl9IhNWRWCh9]v P RPRt}V]cVPQtQStSv uv w tPdPdWo Xo w H "PVVe Ve t VP0TT W o TwzPz\W \  P w \P P w P WVv; V PV g R VV_ e V t t u t u t u P R L R   LL R  0  V D r Q $ Q V V  v VV  W WW XX \\R U PU Z RZ n t  W WW  W WW v vD tRtvR 8W8;H;HPHbHCPHJHJvPNVNvV+8v 8;W;ZLZbv bvL%8v8QQQbvbeQevH LvLLLL V L L Y 0o v Wv vVPL0L f Vf o v|o v VV A PLPP A LLLL A L^ A DLDDl T A Lvl P A Lvl A DLvDl A LLvL} V A Lv} @ p2$q"#  p2$r"#} 0 W  P  W7 9 P^ i P7 9 Q^ i 7 9 H^ ` V` i H p2$q"# T A Lv P A Lv A DLvD A LLvL H  W  HL\W W  Q A Lk V A @Lk@  V  v|  V 0 PP VVLLLLVLLDDPL0LQWJWWVv LVV(Q \L\\ XLXX)8P8<tWWPP !t!#t#utttuttutt/u-BPPPVЮ#Ю_mPPP01t13t3YuYZt`atactcuttPttLuLMtMNtNuPPP"ЮЮ+9PNdPPtt)u)*t01t13t3bubctNUPU\tpqtqutuutteueftfgtgCuPPpgmp&0&-P-`V`gPgm0mwVwP0CVPPP-gЮCЮ6HPP>CPPStSVtV[t`atactcut{ttutuVV((Vr|vxsV0)0)bPbL0PL0sLs0PsPP)AALQOVQbЮЮsЮhzP3PnsPPPP\LLu8mdprintfX logg_closen mprintf+ logg logg_facilityY logg_verbosek logg_nowarn} logg_lock logg_time logg_noflush logg_rotate logg_size logg_file logg_syslog mprintf_disabled mprintf_verbosemprintf_quiet1mprintf_nowarnCmprintf_stdoutUmprintf_send_timeoutglogg_fpylogg_foregroundsmy_getoptmy_getopt_longmmy_getopt_long_only(optarg;optindNopterraoptopte[ :optgetoptfreeoptparse optadditem0 __clam_optionsG clam_optionsBi actsetupjaction|notremovednotmoved & get_versionfreshdbdirOprint_versioncheck_flevelfilelistfilecopydaemonize match_regexcli_is_abspathcountlinesa/uhelpmain9infoKrecursion]belloprintinfectedprintcleanL6.}*scanmanagere,is_valid_hostid,get_hostid.hostid(d& __register_frame_info_bases__register_frame_info9__register_frameo__register_frame_info_table_basesq__register_frame_info_table__register_frame_table__deregister_frame_info_bases__deregister_frame_info__deregister_frameD_Unwind_Find_FDE%__gnuc_va_listA__FILEL__FILE __longlong_t2FILE=size_tOoff_tZoff64_teva_listwuint8_tlonglong_tu_longlong_tulong_tino64_tblkcnt64_tblksize_tsuseconds_tmode_tuid_t gid_tdev_t"nlink_t.pid_t:time_tFtimespecotimestruc_tztimevaltm-fd_setXfd_setstat64flock&cli_file_t7cli_mtargetfacstructEkuint_tsize_t__FILE__FILEYoption[ ,__FILE7__FILEFILEsize_t6uint8_tzoptstruct'clam_option"regex_tcli_file_t cli_mtarget~optioni A__longlong_tZoff64_tzlonglong_tu_longlong_tulong_tino64_tblkcnt64_tblksize_tmode_tuid_tgid_tdev_tnlink_t time_ttimespecAtimestruc_tstat64optstruct & ,__FILE7__FILEFILEsize_t6uint8_tcpid_totime_toptstructVcl_cvdcli_file_tregex_t*cli_mtarget/Vuint8_tsuseconds_ttime_ttimevalsigset_tcli_file_tcli_mtargetRs_infooptstruct6.,__FILE7__FILE __longlong_tFILE(size_t:off_tEoff64_tPint8_tbuint8_tmuint16_tuint32_tuint64_tlonglong_tu_longlong_tulong_tino_tino64_tblkcnt64_tblksize_tmode_tuid_t'gid_t3dev_t?nlink_tKtime_tgtimespectimestruc_trlim_trlimit/stat64<passwddirent]DIRoptstructGs_infocl_error_tcl_engine_field^bytecode_security}bytecode_modecli_section_hashcli_stats_sections stats_section_t clcb_pre_cache7 clcb_pre_scanC clcb_post_scant clcb_sigload clcb_hash clcb_meta clcb_stats_add_sampleO clcb_stats_remove_sample| clcb_stats_decrement_count clcb_stats_submitclcb_stats_flushclcb_stats_get_numclcb_stats_get_sizeclcb_stats_get_hostidcl_cvd@cli_file_tKcli_ftypempool_tcli_dconfregex_tbytecode_metadataFcli_environmentbc_statecli_bccli_all_bc*fp_digitfp_intmp_intcli_crt_hashtypecli_crt_tcli_crtcrtmgrbitset_tagicomtrTicon_matchercli_dbinfo cl_engineFcli_htu32_elementocli_htu32cli_ac_special'cli_ac_patt cli_ac_node!cli_bm_patt!cli_sz_hash"cli_hash_pattG"cli_hash_wildr"cli_lsig_tdbi#cli_ac_lsigcli_matcher:cli_cdb#cli_mtarget`$metachaind& ,size_tauint8_tluint16_t~uint32_tuint64_tupad64_t_pthread_mutexpthread_mutex_t_oncepthread_once_t ix86_tune_indicesix86_arch_indices_Unwind_Ptr_Unwind_Internal_Ptr_sleb128_t_uleb128_tfde_vector5objectdwarf_eh_basessworduworduaddrubytedwarf_cie>dwarf_fde^fdei__gthread_mutex_ttfde_compare_tfde_accumulator7$ F QDi `l  &pp+ /y 6l(d X   5;)2 10q( 8< @ 8< @ @ < @ < l@ .x`3 = iP= b 3 iP6<H}?C6<H}?CTZrv..#K$$\'#K$$\'&&''xss*0L E8>$*m(1]$*1@_  _ _ e % +  +  %    v v;Cv Pv Pv A Pv A Pv  Pk A Pk A PP+03;+036'-#/0J'-#/0J'-#/08'-#/08Yu#Yu#Yc#Yc#%AN%AN%/N%/N0PC0PC0>C0>CssssbsbsbpsbpsGNU C 4.5.2../shared/output.c/var/download/mail/clamav/clamav-0.98.4/clamscan__gnuc_va_list__builtin_va_listunsigned char__FILEhooks_cntx_ptrread_encoded_value_with_base_flagre_magic__orientation__ionolock__seekable__extendedfd__xf_nocheck__fillerlong long unsigned int__longlong_tlong long intblksize_toff_toff64_tshort intuint8_tshort unsigned intu_longlong_tulong_tino64_tblkcnt64_tcomplex long doublesuseconds_tmode_tuid_tgid_tdev_tnlink_tpid_ttime_ttimespectv_sectv_nsectimestruc_ttimevaltv_usectm_sectm_mintm_hourtm_mdaytm_montm_yeartm_wdaytm_ydaytm_isdstfd_setfds_bitsstat64st_devst_pad1st_inost_modest_nlinkst_uidst_gidst_rdevst_pad2st_sizest_atimst_mtimst_ctimst_blksizest_blocksst_fstypest_pad4flockl_typel_whencel_startl_lenl_sysidl_pidl_padCL_TYPE_ANYCL_TYPE_TEXT_ASCIICL_TYPE_TEXT_UTF8CL_TYPE_TEXT_UTF16LECL_TYPE_TEXT_UTF16BECL_TYPE_BINARY_DATACL_TYPE_ERRORCL_TYPE_MSEXECL_TYPE_ELFCL_TYPE_MACHOCL_TYPE_MACHO_UNIBINCL_TYPE_POSIX_TARCL_TYPE_OLD_TARCL_TYPE_CPIO_OLDCL_TYPE_CPIO_ODCCL_TYPE_CPIO_NEWCCL_TYPE_CPIO_CRCCL_TYPE_GZCL_TYPE_ZIPCL_TYPE_BZCL_TYPE_RARCL_TYPE_ARJCL_TYPE_MSSZDDCL_TYPE_MSOLE2CL_TYPE_MSCABCL_TYPE_MSCHMCL_TYPE_SISCL_TYPE_SCRENCCL_TYPE_GRAPHICSCL_TYPE_RIFFCL_TYPE_BINHEXCL_TYPE_TNEFCL_TYPE_CRYPTFFCL_TYPE_PDFCL_TYPE_UUENCODEDCL_TYPE_SCRIPTCL_TYPE_HTML_UTF16CL_TYPE_RTFCL_TYPE_7ZCL_TYPE_SWFCL_TYPE_JAVACL_TYPE_XARCL_TYPE_XZCL_TYPE_OOXML_WORDCL_TYPE_OOXML_PPTCL_TYPE_OOXML_XLCL_TYPE_PART_ANYCL_TYPE_PART_HFSPLUSCL_TYPE_MBRCL_TYPE_HTMLCL_TYPE_MAILCL_TYPE_SFXCL_TYPE_ZIPSFXCL_TYPE_RARSFXCL_TYPE_7ZSFXCL_TYPE_CABSFXCL_TYPE_ARJSFXCL_TYPE_NULSFTCL_TYPE_AUTOITCL_TYPE_ISHIELD_MSICL_TYPE_ISO9660CL_TYPE_DMGCL_TYPE_GPTCL_TYPE_APMCL_TYPE_IGNOREDcli_file_tcli_mtargetactargetfnameac_onlyenable_prefilteringtarget_countfacstructsi_coderename_loggrotate_filerotate_file_lenlogg_openmdprintfdeschandler_argsabufferbuffbytestodotarglenwfdslogg_closemprintfcurrtimeold_umasklogg_noflushtimestrlogg_facility__ioblogg_verboselogg_nowarnlogg_locklogg_timelogg_rotatelogg_sizelogg_filelogg_syslogmprintf_disabledmprintf_verbosemprintf_quietmprintf_nowarnmprintf_stdoutmprintf_send_timeoutoperand_countscli_mtargetslogg_fplogg_foregroundfacilitymap../shared/getopt.cuint_tclam_optionhas_argmy_getoptargcargvcoldoptsargvcharindcolon_modegetopt_ok_getopt_internalshortoptslongoptslongindmy_getopt_long_onlyshortoffDW_CFA_def_cfa_offsetfoundhitsmy_getopt_longoptargoptindopterroptopt../shared/optparser.coptstructstrarglnumargenabled__gthread_activeregflagsnextargnextfilenamelongoptshortoptargtypematch_regexownerdescriptionsuggestedre_nsubre_endpre_gre_gutsregex_toptget_ioptaddopts_lastnewnodeoptaddargoptgetoptfreeoptparsecfgfiletoolmaskignoreoptentryopt_indexlineoptadditem__clam_options../shared/actions.cisdiraction_removegetdestfullpathnewnametmpsaction_copynunameaction_movecopiedactsetupactionnotremovednotmoved../shared/misc.ccl_cvd__stimec_versionsubsigsdsigbuilderget_versionfreshdbdirfdbdirretdirdailyprint_versiondb_timedb_versioncheck_flevelfilelistfilecopydaemonizespecial_patternmatchcli_is_abspathcountlinesclamscan.c__sigbitssigset_ts_infoscandirsifileserrorsrblockshelpmainsigsetcli_dbinforecursionbellprintinfectedprintcleanmanager.cuint16_tuint32_tuint64_tino_trlim_trlimitrlim_currlim_maxpw_passwdpw_namepw_uidpw_gidpw_agepw_commentpw_gecospw_dirpw_shelldirentd_inod_offd_reclend_named_fdd_locd_sized_bufCL_CLEANCL_SUCCESSCL_VIRUSCL_ENULLARGCL_EARGCL_EMALFDBCL_ECVDCL_EVERIFYCL_EUNPACKCL_EOPENCL_ECREATCL_EUNLINKCL_ESTATCL_EREADCL_ESEEKCL_EWRITECL_EDUPCL_EACCESCL_ETMPFILECL_ETMPDIRCL_EMAPCL_EMEMCL_ETIMEOUTCL_BREAKCL_EMAXRECCL_EMAXSIZECL_EMAXFILESCL_EFORMATCL_EPARSECL_EBYTECODECL_EBYTECODE_TESTFAILCL_ELOCKCL_EBUSYCL_ESTATECL_ELAST_ERRORcl_error_tcl_engine_fieldCL_ENGINE_MAX_SCANSIZECL_ENGINE_MAX_FILESIZECL_ENGINE_MAX_RECURSIONCL_ENGINE_MAX_FILESCL_ENGINE_MIN_CC_COUNTCL_ENGINE_MIN_SSN_COUNTCL_ENGINE_PUA_CATEGORIESCL_ENGINE_DB_OPTIONSCL_ENGINE_DB_VERSIONCL_ENGINE_DB_TIMECL_ENGINE_AC_ONLYCL_ENGINE_AC_MINDEPTHCL_ENGINE_AC_MAXDEPTHCL_ENGINE_TMPDIRCL_ENGINE_KEEPTMPCL_ENGINE_BYTECODE_SECURITYCL_ENGINE_BYTECODE_TIMEOUTCL_ENGINE_BYTECODE_MODECL_ENGINE_MAX_EMBEDDEDPECL_ENGINE_MAX_HTMLNORMALIZECL_ENGINE_MAX_HTMLNOTAGSCL_ENGINE_MAX_SCRIPTNORMALIZECL_ENGINE_MAX_ZIPTYPERCGCL_ENGINE_FORCETODISKCL_ENGINE_DISABLE_CACHECL_ENGINE_DISABLE_PE_STATSCL_ENGINE_STATS_TIMEOUTCL_ENGINE_MAX_PARTITIONSCL_ENGINE_MAX_ICONSPEbytecode_securityCL_BYTECODE_TRUST_ALLCL_BYTECODE_TRUST_SIGNEDCL_BYTECODE_TRUST_NOTHINGbytecode_modeCL_BYTECODE_MODE_AUTOCL_BYTECODE_MODE_JITCL_BYTECODE_MODE_INTERPRETERCL_BYTECODE_MODE_TESTCL_BYTECODE_MODE_OFFcli_section_hashcli_stats_sectionsnsectionsstats_section_tclcb_pre_cacheclcb_pre_scanclcb_post_scanclcb_sigloadclcb_hashclcb_metaclcb_stats_add_sampleclcb_stats_remove_sampleclcb_stats_decrement_countclcb_stats_submitcl_enginerefcountdboptionsdbversionac_mindepthac_maxdepthtmpdirkeeptmpengine_optionsmaxscansizemaxfilesizemaxreclevelmaxfilesmin_cc_countmin_ssn_countac_roothm_hdbhm_mdbhm_fpwhitelist_matcherdomainlist_matcherphishcheckcli_dconfftypesptypesignoredpua_catsiconcheckmempoolcmgrcb_sigload_ctxhookshook_lsig_idsbytecode_timeoutmaxembeddedpemaxhtmlnormalizemaxhtmlnotagsmaxscriptnormalizemaxziptypercgstats_dataclcb_stats_flushclcb_stats_get_numclcb_stats_get_sizeclcb_stats_get_hostidmaxpartitionsmaxiconspecli_ftypectypetnameprefix_lengthmpool_tmachoarchivemailotherphishingbytecodestatsbytecode_metadatacompilersigmakertimestampformatlevelminfuncmaxfuncmaxresourcetargetExcludecli_environmentplatform_id_aplatform_id_bplatform_id_ccpp_versionfunctionality_leveldconf_levelengine_versiontriplesysnamereleasemachinebig_endiansizeof_ptrarchos_categoryhas_jit_compiledos_featuresreserved0bc_statebc_skipbc_loadedbc_jitbc_interpbc_disabledcli_bckindnum_typesnum_funcfuncsnum_globalsglobaltys__mstateuses_apiscli_ac_lsigvnameprefixvnamesvnames_cntstart_tiddbgnodesdbgnode_cnthook_lsig_idtrustednumGlobalBytesglobalBytessigtime_idsigmatch_idhook_namecli_bc_funccli_bc_typebitset_tagbitsetcli_bc_dbgnodecli_all_bcall_bcsccountinitedcli_bcenginefp_digitusedsignfp_intmp_intCLI_SHA1RSACLI_MD5RSAcli_crt_hashtypecli_crt_tsubjectissuertbshashserialnot_beforenot_aftercertSigncodeSigntimeSignisBlacklistedprevcli_crtcrtsitemscrtmgrcli_matcherbm_shiftbm_suffixbm_pattabsoffsoff_lenbm_offmodebm_patternsbm_reloff_numbm_absoff_numhwildac_partsigsac_nodesac_patternsac_lsigsac_lsigtableac_nodetableac_pattableac_reloffac_reloff_numac_absoff_numfiltermaxpatlenicomtrgroupcolor_avgcolor_xcolor_ygray_avggray_xgray_ybright_avgbright_xbright_ydark_avgdark_xdark_ynoedge_avgnoedge_xnoedge_yrsumgsumbsumicon_matchergroup_namesgroup_countsiconsicon_countscsizecli_cdbvirnamefsizecfsizeris_encryptedfileposres1res2regex_matcheras_ulongas_ptrcli_htu32_element__datacli_htu32htablecapacitymaxfillcli_ac_specialnegativecli_ac_pattch_mindistch_maxdistlsigidcustomdatapartspartnospecial_tablenext_samehandlertypeoffdataoffset_minoffset_maxboundarycli_ac_nodetransfailcli_bm_pattpattern0cli_sz_hashhash_arrayvirusnamescli_hash_pattsizehashescli_hash_wildcli_lsig_tdbpc_rangefsize_containericongrp1icongrp2macro_ptidsbc_idxlogicmetachainchainslastaddlastvirprint_chainucontextcheckaccessusernameDW_OP_hi_userxstatuscontainer_typefsize_realfilepos_containertoolongpostpresultscanfileincludedvirppdirnamedentdirlnkfilelnkscanstdinfsize__filebreadscanmanagerrlimis_valid_hostidcbdata/builds/hudson/workspace/nightly-update/build/i386/components/gcc45/gcc-4.5.2/libgcc/../gcc/libgcc2.c/builds/hudson/workspace/nightly-update/build/i386/components/gcc45/build/i86/i386-pc-solaris2.11/libgccUSItypeUDItypecomplex floatcomplex double__float128__unknown__DWstructhighDWunion__ctzdi2swordUQItype__popcountsi2__popcount_tab__popcountdi2SFtype__powisf2DFtype__powidf2__udivmoddi4__divdi3__moddi3__udivdi3__umoddi3ix86_tune_indicesX86_TUNE_USE_LEAVEX86_TUNE_PUSH_MEMORYX86_TUNE_ZERO_EXTEND_WITH_ANDX86_TUNE_UNROLL_STRLENX86_TUNE_DEEP_BRANCH_PREDICTIONX86_TUNE_BRANCH_PREDICTION_HINTSX86_TUNE_DOUBLE_WITH_ADDX86_TUNE_USE_SAHFX86_TUNE_MOVXX86_TUNE_PARTIAL_REG_STALLX86_TUNE_PARTIAL_FLAG_REG_STALLX86_TUNE_USE_HIMODE_FIOPX86_TUNE_USE_SIMODE_FIOPX86_TUNE_USE_MOV0X86_TUNE_USE_CLTDX86_TUNE_USE_XCHGBX86_TUNE_SPLIT_LONG_MOVESX86_TUNE_READ_MODIFY_WRITEX86_TUNE_READ_MODIFYX86_TUNE_PROMOTE_QIMODEX86_TUNE_FAST_PREFIXX86_TUNE_SINGLE_STRINGOPX86_TUNE_QIMODE_MATHX86_TUNE_HIMODE_MATHX86_TUNE_PROMOTE_QI_REGSX86_TUNE_PROMOTE_HI_REGSX86_TUNE_ADD_ESP_4X86_TUNE_ADD_ESP_8X86_TUNE_SUB_ESP_4X86_TUNE_SUB_ESP_8X86_TUNE_INTEGER_DFMODE_MOVESX86_TUNE_PARTIAL_REG_DEPENDENCYX86_TUNE_SSE_PARTIAL_REG_DEPENDENCYX86_TUNE_SSE_UNALIGNED_MOVE_OPTIMALX86_TUNE_SSE_SPLIT_REGSX86_TUNE_SSE_TYPELESS_STORESX86_TUNE_SSE_LOAD0_BY_PXORX86_TUNE_MEMORY_MISMATCH_STALLX86_TUNE_PROLOGUE_USING_MOVEX86_TUNE_EPILOGUE_USING_MOVEX86_TUNE_SHIFT1X86_TUNE_USE_FFREEPX86_TUNE_INTER_UNIT_MOVESX86_TUNE_INTER_UNIT_CONVERSIONSX86_TUNE_FOUR_JUMP_LIMITX86_TUNE_SCHEDULEX86_TUNE_USE_BTX86_TUNE_USE_INCDECX86_TUNE_PAD_RETURNSX86_TUNE_EXT_80387_CONSTANTSX86_TUNE_SHORTEN_X87_SSEX86_TUNE_AVOID_VECTOR_DECODEX86_TUNE_PROMOTE_HIMODE_IMULX86_TUNE_SLOW_IMUL_IMM32_MEMX86_TUNE_SLOW_IMUL_IMM8X86_TUNE_MOVE_M1_VIA_ORX86_TUNE_NOT_UNPAIRABLEX86_TUNE_NOT_VECTORMODEX86_TUNE_USE_VECTOR_FP_CONVERTSX86_TUNE_USE_VECTOR_CONVERTSX86_TUNE_FUSE_CMP_AND_BRANCHX86_TUNE_OPT_AGUX86_TUNE_LASTix86_arch_indicesX86_ARCH_CMOVEX86_ARCH_CMPXCHGX86_ARCH_CMPXCHG8BX86_ARCH_XADDX86_ARCH_BSWAPX86_ARCH_LAST/builds/hudson/workspace/nightly-update/build/i386/components/gcc45/gcc-4.5.2/libgcc/../gcc/unwind-dw2.ccaddr_tupad64_tupad128_tzoneid_tctid_t__pthread_mutex_flag1__pthread_mutex_flag2__pthread_mutex_ceiling__pthread_mutex_type__pthread_mutex_magic__pthread_mutex_pad__pthread_ownerpid__pthread_lockword__pthread_mutex_lock64__pthread_mutex_lock32__pthread_mutex_owner64_pthread_mutex__pthread_mutex_flags__pthread_mutex_lock__pthread_mutex_datapthread_mutex_t__once__pthread_once_padpthread_once_tclock_tsigvalsival_intsival_ptr__uid__value__tid__utime__status__kill__cld__pid__pdata__ctid__zoneid__addr__trapno__pc__fd__band__faddr__tstamp__syscall__nsysarg__fault__sysarg__entity__pad__proc__prof__rctlsiginfosi_signosi_errnosiginfo_tsigaltstackss_spss_sizess_flagsstack_tdwarf_location_atomDW_OP_addrDW_OP_derefDW_OP_const1uDW_OP_const1sDW_OP_const2uDW_OP_const2sDW_OP_const4uDW_OP_const4sDW_OP_const8uDW_OP_const8sDW_OP_constuDW_OP_constsDW_OP_dupDW_OP_dropDW_OP_overDW_OP_pickDW_OP_swapDW_OP_rotDW_OP_xderefDW_OP_absDW_OP_andDW_OP_divDW_OP_minusDW_OP_modDW_OP_mulDW_OP_negDW_OP_notDW_OP_orDW_OP_plusDW_OP_plus_uconstDW_OP_shlDW_OP_shrDW_OP_shraDW_OP_xorDW_OP_braDW_OP_eqDW_OP_geDW_OP_gtDW_OP_leDW_OP_ltDW_OP_neDW_OP_skipDW_OP_lit0DW_OP_lit1DW_OP_lit2DW_OP_lit3DW_OP_lit4DW_OP_lit5DW_OP_lit6DW_OP_lit7DW_OP_lit8DW_OP_lit9DW_OP_lit10DW_OP_lit11DW_OP_lit12DW_OP_lit13DW_OP_lit14DW_OP_lit15DW_OP_lit16DW_OP_lit17DW_OP_lit18DW_OP_lit19DW_OP_lit20DW_OP_lit21DW_OP_lit22DW_OP_lit23DW_OP_lit24DW_OP_lit25DW_OP_lit26DW_OP_lit27DW_OP_lit28DW_OP_lit29DW_OP_lit30DW_OP_lit31DW_OP_reg0DW_OP_reg1DW_OP_reg2DW_OP_reg3DW_OP_reg4DW_OP_reg5DW_OP_reg6DW_OP_reg7DW_OP_reg8DW_OP_reg9DW_OP_reg10DW_OP_reg11DW_OP_reg12DW_OP_reg13DW_OP_reg14DW_OP_reg15DW_OP_reg16DW_OP_reg17DW_OP_reg18DW_OP_reg19DW_OP_reg20DW_OP_reg21DW_OP_reg22DW_OP_reg23DW_OP_reg24DW_OP_reg25DW_OP_reg26DW_OP_reg27DW_OP_reg28DW_OP_reg29DW_OP_reg30DW_OP_reg31DW_OP_breg0DW_OP_breg1DW_OP_breg2DW_OP_breg3DW_OP_breg4DW_OP_breg5DW_OP_breg6DW_OP_breg7DW_OP_breg8DW_OP_breg9DW_OP_breg10DW_OP_breg11DW_OP_breg12DW_OP_breg13DW_OP_breg14DW_OP_breg15DW_OP_breg16DW_OP_breg17DW_OP_breg18DW_OP_breg19DW_OP_breg20DW_OP_breg21DW_OP_breg22DW_OP_breg23DW_OP_breg24DW_OP_breg25DW_OP_breg26DW_OP_breg27DW_OP_breg28DW_OP_breg29DW_OP_breg30DW_OP_breg31DW_OP_regxDW_OP_fbregDW_OP_bregxDW_OP_pieceDW_OP_deref_sizeDW_OP_xderef_sizeDW_OP_nopDW_OP_push_object_addressDW_OP_call2DW_OP_call4DW_OP_call_refDW_OP_form_tls_addressDW_OP_call_frame_cfaDW_OP_bit_pieceDW_OP_implicit_valueDW_OP_stack_valueDW_OP_lo_userDW_OP_GNU_push_tls_addressDW_OP_GNU_uninitDW_OP_GNU_encoded_addrDW_OP_HP_unknownDW_OP_HP_is_valueDW_OP_HP_fltconst4DW_OP_HP_fltconst8DW_OP_HP_mod_rangeDW_OP_HP_unmod_rangeDW_OP_HP_tlsDW_OP_PGI_omp_thread_numdwarf_call_frame_infoDW_CFA_advance_locDW_CFA_offsetDW_CFA_restoreDW_CFA_nopDW_CFA_set_locDW_CFA_advance_loc1DW_CFA_advance_loc2DW_CFA_advance_loc4DW_CFA_offset_extendedDW_CFA_restore_extendedDW_CFA_undefinedDW_CFA_same_valueDW_CFA_registerDW_CFA_remember_stateDW_CFA_restore_stateDW_CFA_def_cfaDW_CFA_def_cfa_registerDW_CFA_def_cfa_expressionDW_CFA_expressionDW_CFA_offset_extended_sfDW_CFA_def_cfa_sfDW_CFA_def_cfa_offset_sfDW_CFA_val_offsetDW_CFA_val_offset_sfDW_CFA_val_expressionDW_CFA_lo_userDW_CFA_hi_userDW_CFA_MIPS_advance_loc8DW_CFA_GNU_window_saveDW_CFA_GNU_args_sizeDW_CFA_GNU_negative_offset_extended_Unwind_Word_Unwind_Sword_Unwind_Ptr_Unwind_Internal_Ptr_Unwind_Exception_Class_URC_NO_REASON_URC_FOREIGN_EXCEPTION_CAUGHT_URC_FATAL_PHASE2_ERROR_URC_FATAL_PHASE1_ERROR_URC_NORMAL_STOP_URC_END_OF_STACK_URC_HANDLER_FOUND_URC_INSTALL_CONTEXT_URC_CONTINUE_UNWIND_Unwind_Reason_Code_Unwind_Exception_Cleanup_Fn_Unwind_Exceptionexception_classexception_cleanupprivate_1private_2_Unwind_Action_Unwind_Stop_Fn_Unwind_Contextlsdadwarf_eh_basesby_value_Unwind_Trace_Fn_Unwind_Personality_Fn_sleb128_t_uleb128_tdwarf_fdeCIE_deltapc_begintbasedbase__funcuwordubytedwarf_cieCIE_idaugmentation__gthread_once_tREG_UNSAVEDREG_SAVED_OFFSETREG_SAVED_REGREG_SAVED_EXPREG_SAVED_VAL_OFFSETREG_SAVED_VAL_EXPREG_UNDEFINEDCFA_UNSETCFA_REG_OFFSETCFA_EXPframe_state_reg_infocfa_regcfa_expcfa_howgregspersonalitydata_aligncode_alignretaddr_columnget_fde_encodinglsda_encodingsaw_zsignal_frameeh_ptr_Unwind_FrameStateunalignedgreg_tgregset_tfpchip_statemxcsrfp_emul_spacefp_emulfp_epadf_fpregsfp_reg_setfpregset_tmcontext_txrs_idxrs_ptrxrs_tucontext_tuc_flagsuc_linkuc_sigmaskuc_stackuc_mcontextuc_xrsuc_fillerx86_fallback_frame_statereg_or_offsetsaved_Unwind_SpTmp_Unwind_IsSignalFrame_Unwind_SetSignalFrame_Unwind_IsExtendedContextmctxnew_cfaread_uleb128_Unwind_SetGRPtr__gthread_active_p__gthread_active_mutex__gthread_active_once__gthread_active_latest_value_Unwind_GetGRPtr_Unwind_GetPtr_Unwind_GetCFAuw_identify_context_Unwind_GetTextRelBase_Unwind_GetDataRelBase_Unwind_GetRegionStartbase_of_encoded_valuex_encodingread_pointerread_1uread_1sread_2uread_2sread_4uread_4sread_8uread_8s_Unwind_GRByValue_Unwind_SetGRValueget_cienext_fdesize_of_encoded_value__gthread_onceuw_advance_contextread_sleb128__gthread_triggerinit_dwarf_reg_size_tableread_encoded_valueexecute_cfa_programinsn_ptrinsn_endunused_rsip_before_insnutmpstmpnew_rsold_rsextract_cie_infouw_frame_state_for_Unwind_GetGRexecute_stack_opop_ptrop_endinitialstack_eltno_pushfirstsecond_Unwind_SetSpColumntmp_spuw_update_context_1orig_contextuw_update_context_Unwind_ForcedUnwind_Phase2stopstop_argumentstop_code_Unwind_RaiseException_Phase2match_handleruw_init_context_1outer_cfaouter_rasp_slotonce_regsizesuw_install_context_1currenttarget_cfa_Unwind_SetGR_Unwind_GetIP_Unwind_GetIPInfo_Unwind_SetIP_Unwind_GetLanguageSpecificData_Unwind_FindEnclosingFunction__frame_state_forpc_targetstate_in_Unwind_DebugHook_Unwind_RaiseExceptionthis_contextcur_context_Unwind_ForcedUnwind_Unwind_Resume_Unwind_Resume_or_Rethrow_Unwind_DeleteException_Unwind_Backtracetrace_argument/builds/hudson/workspace/nightly-update/build/i386/components/gcc45/gcc-4.5.2/libgcc/../gcc/unwind-dw2-fde.cfde_vectororig_datapc_arraysingleend_fde_sortsortedfrom_arraymixed_encodinginit_objectuaddr__gthread_mutex_tfde_compare_tfde_accumulatorlinearerraticlast_fdefde_insertaccuthis_fdebinary_search_unencoded_fdesbase_from_objectadd_fdeslast_ciethis_ciefde_splitfde_comparemarkerchain_endprobefde_mergefde2start_fde_sortbinary_search_mixed_encoding_fdesbinary_search_single_encoding_fdes__deregister_frame_info__gthread_mutex_lock__mutex__gthread_mutex_unlockfde_unencoded_comparey_ptrframe_downheapframe_heapsortget_cie_encodingdummyclassify_object_over_fdesfde_single_encoding_comparelinear_search_fdessearch_objectfde_mixed_encoding_comparey_encoding__register_frame_info_bases__register_frame_info__register_frame__register_frame_info_table_bases__register_frame_info_table__register_frame_table__deregister_frame_info_bases__deregister_frame_Unwind_Find_FDEfiniunseen_objectsobject_mutex| ,7FAB LB AAA D @;7AB i D <;AB LQ AAA E  AAA D ,0>AB Ly AAA E 0ETAG Du AA E IAA | , FAB I AAA H <@JBAB I_ AAA B ^ AAA G P1ACDcAP1ACDcA| $QUAB CCIAA ,pQAB CF] AAA C ,SAB IFEv AB $UUAB HGAA (`UAB IAAA <0VAB ^* AAA A F AAA A <fAB I AAA A u AAA A | (<`lMAB G` A E [A <<l AB DG AAA B d AAA A (<mAB H` AA C (<pnAB HU AA F 4<`o AB Kv AA B O AA G |  Lpp8LpDAB L AA K AD 8LrAB IQ AB  AD $LtDAB R C k 8LtAB LFFj AB  AH Lv CC8LvAB U AAA B I AAA D ,L@xAB LFF AD L y(L0ykAB E_AAA |  y.AB * | }AB Iu  "u  "u  "o AAB AH { AAB AH W AAB AD u AAB AA |  ,%AB HEEh AB ,AB E AAA G ,AG FK/ AAA E (AB LF^ AD L0AB CCC\ AAA E  AAA F  AAA A H6AB E` AAA E  AAA A b AAA H 8@AB LXo AA z AE <|AG KHp AL O AH J A|   @3C O`(AB E AA B $@AB EAA <hAB Dv A B I A F I A F FA ,PHAD F\i AG HAB BHU AAA C  AAA F F AAA G 8bAB Ds A E F A A I A F ( LAB B" AA G $pAB E|AA 0cAB BI AA H HAA (p'AB AFAA <AB F AAA H O EAA A $@AB EAA 8_AB INHS AB x AA P*AB f $BAB FFq A,оKAB FL AA  *AB f  P3AB AmA 8AD FFNO AA  AA p CC 1AB DhA ,)AB C> AAA A  .interp.eh_frame_hdr.hash.SUNW_ldynsym.dynsym.dynstr.SUNW_version.SUNW_versym.SUNW_dynsymsort.SUNW_reloc.rel.plt.text.init.fini.rodata.rodata.str1.1.rodata.str1.4.rodata.cst4.got.dynamic.eh_frame.data.ctors.dtors.jcr.bss.symtab.strtab.comment.debug_abbrev.debug_info.debug_line.debug_loc.debug_pubnames.debug_pubtypes.debug_aranges.debug_ranges.debug_str.debug_frame.shstrtab  4oHH:+   ` 3"HHe;o&&Io''Vo ) )g **(s B**w..@|55\@@``9 2?2\\``LLh``  @@E @  0X*Ql%6<jA:.QhA ap ~0xD$^4  Xk